Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.51
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
PONTOCEREBELLAR HYPOPLASIA, TYPE 2E 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.4
Prostate cancer 175 0.0 3.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Hypomyelinating leukodystrophy 6 26 4.561 2.3

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 2.2e-04
Astrocytoma, Pilocytic -1.100 1.7e-05
atypical teratoid / rhabdoid tumor -1.100 4.3e-06
diabetes mellitus -1.100 1.4e-03
ependymoma -1.400 1.1e-10
glioblastoma -1.500 1.8e-06
group 4 medulloblastoma -1.100 2.7e-05
intraductal papillary-mucinous carcinoma... 1.200 1.5e-04
intraductal papillary-mucinous neoplasm ... 1.300 5.0e-03
medulloblastoma, large-cell -1.300 1.9e-03
non primary Sjogren syndrome sicca -1.400 2.1e-02
osteosarcoma -1.632 4.8e-06
ovarian cancer 1.200 2.3e-10
primitive neuroectodermal tumor -1.300 4.0e-04

Protein-protein Interaction (5)

Gene RIF (6)

AA Sequence

MMEEEELEFVEELEAVLQLTPEVQLAIEQVFPSQDPLDRADFNAVEYINTLFPTEQSLANIDEVVNKIRL      1 - 70
KIRRLDDNIRTVVRGQTNVGQDGRQALEEAQKAIQQLFGKIKDIKDKAEKSEQMVKEITRDIKQLDHAKR     71 - 140
HLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQGVMNVLEHFHKYMGIPQIRQLSERVKAAQTE    141 - 210
LGQQILADFEEAFPSQGTKRPGGPSNVLRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAW    211 - 280
LDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLLLFAIQR    281 - 350
TTNFEGFLAKRFSGCTLTDGTLKKLESPPPSTNPFLEDEPTPEMEELATEKGDLDQPKKPKAPDNPFHGI    351 - 420
VSKCFEPHLYVYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKKCMVQCSQLST    421 - 490
GEPMIALTTIFQKYLREYAWKILSGNLPKTTTSSGGLTISSLLKEKEGSEVAKFTLEELCLICNILSTAE    491 - 560
YCLATTQQLEEKLKEKVDVSLIERINLTGEMDTFSTVISSSIQLLVQDLDAACDPALTAMSKMQWQNVEH    561 - 630
VGDQSPYVTSVILHIKQNVPIIRDNLASTRKYFTQFCVKFANSFIPKFITHLFKCKPISMVGAEQVRWT     631 - 699
//

Text Mined References (22)

PMID Year Title