Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.77
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VIR6 A8K2S8 B3FH42 Q8WYW3 Q9BRR2 Q9BY02 Q9NV25
Symbols HCCS1
PCH2E
hVps53L
pp13624

Gene

Gene RIF (6)

PMID Text
19620288 Golgi-associated retrograde protein orchestrates retrograde transport from endosomes to the trans-Golgi network by promoting vesicle tethering and assembly of SNARE complexes in consecutive, independent steps.[Golgi associated retrograde protein]
18367545 Missorting of cathepsin D in GARP-depleted cells results from accumulation of recycling MPRs in a population of light, small vesicles downstream of endosomes.
18187620 Knockdown of vacuolar protein sorting 53 homolog (VPS53) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17666431 Amphipathic tail-anchoring peptide (ATAP) targets specifically to mitochondria, and induces caspase-dependent apoptosis that does not require Bax or Bak.
16953216 Data show that transcription of the putative tumor suppressor gene HCCS1 requires binding of ETS-2 to its consensus near the transcription start site; observations provide insight into the mechanistic aspects of HCCS1 transcription regulation
15878329 Golgi associated retrograde protein complex, consisting of the Vps52, Vps53, and Vps54 proteins, shows significant conservation between various species but diversification and specialization result in important differences in human cells.

AA Sequence

MMEEEELEFVEELEAVLQLTPEVQLAIEQVFPSQDPLDRADFNAVEYINTLFPTEQSLANIDEVVNKIRL      1 - 70
KIRRLDDNIRTVVRGQTNVGQDGRQALEEAQKAIQQLFGKIKDIKDKAEKSEQMVKEITRDIKQLDHAKR     71 - 140
HLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQGVMNVLEHFHKYMGIPQIRQLSERVKAAQTE    141 - 210
LGQQILADFEEAFPSQGTKRPGGPSNVLRDACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQDVAW    211 - 280
LDKIDRRYAWIKRQLVDYEEKYGRMFPREWCMAERIAVEFCHVTRAELAKIMRTRAKEIEVKLLLFAIQR    281 - 350
TTNFEGFLAKRFSGCTLTDGTLKKLESPPPSTNPFLEDEPTPEMEELATEKGDLDQPKKPKAPDNPFHGI    351 - 420
VSKCFEPHLYVYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKKCMVQCSQLST    421 - 490
GEPMIALTTIFQKYLREYAWKILSGNLPKTTTSSGGLTISSLLKEKEGSEVAKFTLEELCLICNILSTAE    491 - 560
YCLATTQQLEEKLKEKVDVSLIERINLTGEMDTFSTVISSSIQLLVQDLDAACDPALTAMSKMQWQNVEH    561 - 630
VGDQSPYVTSVILHIKQNVPIIRDNLASTRKYFTQFCVKFANSFIPKFITHLFKCKPISMVGAEQVRWT     631 - 699
//

Text Mined References (22)

PMID Year Title
25799061 2015 EARP is a multisubunit tethering complex involved in endocytic recycling.
24577744 2014 VPS53 mutations cause progressive cerebello-cerebral atrophy type 2 (PCCA2).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
21269460 2011 Initial characterization of the human central proteome.
20685960 2010 Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19620288 2009 Dual roles of the mammalian GARP complex in tethering and SNARE complex assembly at the trans-golgi network.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...