Property Summary

NCBI Gene PubMed Count 17
Grant Count 79
R01 Count 43
Funding $14,013,714.38
PubMed Score 0.97
PubTator Score 124.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.700 0.002
osteosarcoma 2.937 0.000
periodontitis -1.200 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell 1.100 0.000
juvenile dermatomyositis 1.479 0.000
tuberculosis -1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.034
lung cancer 1.100 0.002
adult high grade glioma -1.100 0.001
sonic hedgehog group medulloblastoma 1.100 0.000
nasopharyngeal carcinoma 1.200 0.001
Pick disease 1.100 0.002
ulcerative colitis 1.100 0.002
ovarian cancer 2.200 0.000

Gene

Gene RIF (9)

PMID Text
26256213 These data reveal a thus far unrecognized function for Rif1 in the resolution of ultrafine DNA bridges during anaphase to protect genomic integrity.
24462468 RIF1 is an important component in DNA damage response signaling. [Review]
23486525 RIF1 not only acts downstream of 53BP1 and counteracts BRCA1-mediated end resection but also has a secondary role in promoting BLM function in DNA repair.
23333306 RIF1 as the critical effector of 53BP1 during DSB repair
22850674 Rif1 plays crucial roles in determining the replication timing domain structures in human cells through regulating higher-order chromatin architecture
20677014 Observational study of gene-disease association. (HuGE Navigator)
19483192 High RIF1 expression is associated with breast tumors.
15583028 In telophase, hRif1 localized to chromosomes, and in interphase, it was intranuclear. These results define a novel subcellular localization behavior for hRif1 during the cell cycle.
15342490 Rif1 functions in the intra-S-phase checkpoint that serves to slow down DNA synthesis when DNA damage has occurred.

AA Sequence

MTARGQSPLAPLLETLEDPSASHGGQTDAYLTLTSRMTGEEGKEVITEIEKKLPRLYKVLKTHISSQNSE      1 - 70
LSSAALQALGFCLYNPKITSELSEANALELLSKLNDTIKNSDKNVRTRALWVISKQTFPSEVVGKMVSSI     71 - 140
IDSLEILFNKGETHSAVVDFEALNVIVRLIEQAPIQMGEEAVRWAKLVIPLVVHSAQKVHLRGATALEMG    141 - 210
MPLLLQKQQEIASITEQLMTTKLISELQKLFMSKNETYVLKLWPLFVKLLGRTLHRSGSFINSLLQLEEL    211 - 280
GFRSGAPMIKKIAFIAWKSLIDNFALNPDILCSAKRLKLLMQPLSSIHVRTETLALTKLEVWWYLLMRLG    281 - 350
PHLPANFEQVCVPLIQSTISIDSNASPQGNSCHVATSPGLNPMTPVHKGASSPYGAPGTPRMNLSSNLGG    351 - 420
MATIPSIQLLGLEMLLHFLLGPEALSFAKQNKLVLSLEPLEHPLISSPSFFSKHANTLITAVHDSFVAVG    421 - 490
KDAPDVVVSAIWKELISLVKSVTESGNKKEKPGSEVLTLLLKSLESIVKSEVFPVSKTLVLMEITIKGLP    491 - 560
QKVLGSPAYQVANMDILNGTPALFLIQLIFNNFLECGVSDERFFLSLESLVGCVLSGPTSPLAFSDSVLN    561 - 630
VINQNAKQLENKEHLWKMWSVIVTPLTELINQTNEVNQGDALEHNFSAIYGALTLPVNHIFSEQRFPVAT    631 - 700
MKTLLRTWSELYRAFARCAALVATAEENLCCEELSSKIMSSLEDEGFSNLLFVDRIIYIITVMVDCIDFS    701 - 770
PYNIKYQPKVKSPQRPSDWSKKKNEPLGKLTSLFKLIVKVIYSFHTLSFKEAHSDTLFTIGNSITGIISS    771 - 840
VLGHISLPSMIRKIFATLTRPLALFYENSKLDEVPKVYSCLNNKLEKLLGEIIACLQFSYTGTYDSELLE    841 - 910
QLSPLLCIIFLHKNKQIRKQSAQFWNATFAKVMMLVYPEELKPVLTQAKQKFLLLLPGLETVEMMEESSG    911 - 980
PYSDGTENSQLNVKISGMERKSNGKRDSFLAQTKNKKENMKPAAKLKLESSSLKVKGEILLEEEKSTDFV    981 - 1050
FIPPEGKDAKERILTDHQKEVLKTKRCDIPAMYNNLDVSQDTLFTQYSQEEPMEIPTLTRKPKEDSKMMI   1051 - 1120
TEEQMDSDIVIPQDVTEDCGMAEHLEKSSLSNNECGSLDKTSPEMSNSNNDERKKALISSRKTSTECASS   1121 - 1190
TENSFVVSSSSVSNTTVAGTPPYPTSRRQTFITLEKFDGSENRPFSPSPLNNISSTVTVKNNQETMIKTD   1191 - 1260
FLPKAKQREGTFSKSDSEKIVNGTKRSSRRAGKAEQTGNKRSKPLMRSEPEKNTEESVEGIVVLENNPPG   1261 - 1330
LLNQTECVSDNQVHLSESTMEHDNTKLKAATVENAVLLETNTVEEKNVEINLESKENTPPVVISADQMVN   1331 - 1400
EDSQVQITPNQKTLRRSSRRRSEVVESTTESQDKENSHQKKERRKEEEKPLQKSPLHIKDDVLPKQKLIA   1401 - 1470
EQTLQENLIEKGSNLHEKTLGETSANAETEQNKKKADPENIKSEGDGTQDIVDKSSEKLVRGRTRYQTRR   1471 - 1540
ASQGLLSSIENSESDSSEAKEEGSRKKRSGKWKNKSNESVDIQDQEEKVVKQECIKAENQSHDYKATSEE   1541 - 1610
DVSIKSPICEKQDESNTVICQDSTVTSDLLQVPDDLPNVCEEKNETSKYAEYSFTSLPVPESNLRTRNAI   1611 - 1680
KRLHKRDSFDNCSLGESSKIGISDISSLSEKTFQTLECQHKRSRRVRRSKGCDCCGEKSQPQEKSLIGLK   1681 - 1750
NTENNDVEISETKKADVQAPVSPSETSQANPYSEGQFLDEHHSVNFHLGLKEDNDTINDSLIVSETKSKE   1751 - 1820
NTMQESLPSGIVNFREEICDMDSSEAMSLESQESPNENFKTVGPCLGDSKNVSQESLETKEEKPEETPKM   1821 - 1890
ELSLENVTVEGNACKVTESNLEKAKTMELNVGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLN   1891 - 1960
AKEVATEEFNSDISLSDNTTPVKLNAQTEISEQTAAGELDGGNDVSDLHSSEETNTKMKNNEEMMIGEAM   1961 - 2030
AETGHDGETENEGITTKTSKPDEAETNMLTAEMDNFVCDTVEMSTEEGIIDANKTETNTEYSKSEEKLDN   2031 - 2100
NQMVMESDILQEDHHTSQKVEEPSQCLASGTAISELIIEDNNASPQKLRELDPSLVSANDSPSGMQTRCV   2101 - 2170
WSPLASPSTSILKRGLKRSQEDEISSPVNKVRRVSFADPIYQAGLADDIDRRCSIVRSHSSNSSPIGKSV   2171 - 2240
KTSPTTQSKHNTTSAKGFLSPGSRSPKFKSSKKCLISEMAKESIPCPTESVYPPLVNCVAPVDIILPQIT   2241 - 2310
SNMWARGLGQLIRAKNIKTIGDLSTLTASEIKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDIS   2311 - 2380
EKTVNGIENKSLSPDEERLVSDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSC   2381 - 2450
MANSVIKNLQSRWRSPSHENSI                                                   2451 - 2472
//

Text Mined References (30)

PMID Year Title
26256213 2015 Rif1 Is Required for Resolution of Ultrafine DNA Bridges in Anaphase to Ensure Genomic Stability.
24462468 2014 RIF1: a novel regulatory factor for DNA replication and DNA damage response signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23486525 2013 RIF1 counteracts BRCA1-mediated end resection during DNA repair.
23333306 2013 A cell cycle-dependent regulatory circuit composed of 53BP1-RIF1 and BRCA1-CtIP controls DNA repair pathway choice.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143601 2012 Genome-wide association analysis identifies new lung cancer susceptibility loci in never-smoking women in Asia.
22850674 2012 Rif1 regulates the replication timing domains on the human genome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...