Property Summary

NCBI Gene PubMed Count 9
Grant Count 10
R01 Count 10
Funding $712,545.2
PubMed Score 23.98
PubTator Score 6.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 0.016
psoriasis -1.800 0.000
osteosarcoma -2.200 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.200 0.000
pilocytic astrocytoma 1.400 0.000
lung carcinoma 1.200 0.000

Gene RIF (4)

PMID Text
25481245 hHSS1-overexpression modulates signaling pathways involved in tumorigenesis.
20680400 High-expression of hHSS1 is associated high-grade gliomas.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19570817 as a novel secreted protein, INM02 is associated with functions of pancreatic islets, especially of beta-cells

AA Sequence

MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK      1 - 70
RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES     71 - 140
HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA    141 - 210
QKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDTGGQGGGGGGGGGGGSGR                      211 - 262
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25481245 2014 Human Hematopoietic Signal peptide-containing Secreted 1 (hHSS1) modulates genes and pathways in glioma: implications for the regulation of tumorigenicity and angiogenesis.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
20680400 2011 hHSS1: a novel secreted factor and suppressor of glioma growth located at chromosome 19q13.33.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19570817 2009 Molecular cloning of a novel secreted peptide, INM02, and regulation of its expression by glucose.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...