Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.14
PubTator Score 1.08

Knowledge Summary

Patent (413)

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy -1.089 3.2e-04
cystic fibrosis 1.219 2.4e-04
Duchenne muscular dystrophy -1.006 3.2e-06
pancreatic cancer 1.300 2.1e-03
primary pancreatic ductal adenocarcinoma 1.059 7.5e-03
tuberculosis -2.200 3.9e-09

AA Sequence

MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQ      1 - 70
NFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAV     71 - 140
ALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPIL    141 - 210
SQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFV    211 - 280
LCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST                   281 - 335
//

Text Mined References (5)

PMID Year Title