Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.14
PubTator Score 1.08

Knowledge Summary

Patent (413)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 3.87575672591639E-9
Duchenne muscular dystrophy 602 3.20857814267646E-6
cystic fibrosis 1670 2.40043720338156E-4
acute quadriplegic myopathy 1157 3.19908438436284E-4
pancreatic cancer 2300 0.00207405950002448
primary pancreatic ductal adenocarcinoma 1271 0.00747269288187826
Disease Target Count Z-score Confidence
Schnyder Corneal Dystrophy 24 5.125 2.6

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 1.219 0.000
Duchenne muscular dystrophy -1.006 0.000
acute quadriplegic myopathy -1.089 0.000
primary pancreatic ductal adenocarcinoma 1.059 0.007
tuberculosis -2.200 0.000
pancreatic cancer 1.300 0.002

Synonym

Accession Q5UAW9 A2A334 Q8WWB8 Q9HA73
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (9)

  TechDev Info (2)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

AA Sequence

MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQ      1 - 70
NFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAV     71 - 140
ALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPIL    141 - 210
SQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFV    211 - 280
LCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST                   281 - 335
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.