Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
R01 Count 7
Funding $511,153.91
PubMed Score 16.94
PubTator Score 107.46

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23798437 results reveal an effector pathway for Rap1 in the modulation of Rho signaling and actin dynamics, through which Rap1 modulates endothelial barrier function
21060863 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15031288 Rain is a novel protein that can serve as an effector of endomembrane-localized Ras

AA Sequence

MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPLPPPPPHVELR      1 - 70
RVGAVKAAGGASGSRAKRISQLFRGSGTGTTGSSGAGGPGTPGGAQRWASEKKLPELAAGVAPEPPLATR     71 - 140
ATAPPGVLKIFGAGLASGANYKSVLATARSTARELVAEALERYGLAGSPGGGPGESSCVDAFALCDALGR    141 - 210
PAAAGVGSGEWRAEHLRVLGDSERPLLVQELWRARPGWARRFELRGREEARRLEQEAFGAADSEGTGAPS    211 - 280
WRPQKNRSRAASGGAALASPGPGTGSGAPAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMA    281 - 350
PGAADAQIGTADPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSP    351 - 420
APYVDTFLNAPDILPRHCTVRAGPEHPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYKDP    421 - 490
RTGGSGPARPPWLPARPGATPPGPGWAFSCRLCGRGLQERGEALAAYLDGREPVLRFRPREEEALLGEIV    491 - 560
RAAAAGSGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLIKEAVWEKIKEIGDRQPENHPEGVP    561 - 630
EVPLTPEAVSVELRPLMLWMANTTELLSFVQEKVLEMEKEADQEDPQLCNDLELCDEAMALLDEVIMCTF    631 - 700
QQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRPTLGVFQAALELTSQCELHPDLVSQ    701 - 770
TFGYLFFFSNASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIATEFFRKLSMAVNLLC    771 - 840
VPRTSLLKASWSSLRTDHPTLTPAQLHHLLSHYQLGPGRGPPAAWDPPPAEREAVDTGDIFESFSSHPPL    841 - 910
ILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANYRHGPPVATSP                     911 - 963
//

Text Mined References (14)

PMID Year Title
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24586186 2014 Genome-wide association study of metabolic traits reveals novel gene-metabolite-disease links.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23798437 2013 Rasip1 mediates Rap1 regulation of Rho in endothelial barrier function through ArhGAP29.
23372041 2013 Novel locus including FGF21 is associated with dietary macronutrient intake.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...