Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.04
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 8.96713002359555E-18
adrenocortical carcinoma 1427 9.68807852626594E-7
atypical teratoid / rhabdoid tumor 4369 2.68577215717237E-5
group 4 medulloblastoma 1875 7.69309370170219E-5
medulloblastoma, large-cell 6234 2.6967301970226E-4
primitive neuroectodermal tumor 3031 4.71439898917134E-4
Disease Target Count Z-score Confidence
Li-Fraumeni syndrome 13 3.638 1.8
Disease Target Count
Diarrhea 6 2
Meconium ileus 2

Expression

  Differential Expression (6)

Synonym

Accession Q5U649 A8K1M7 Q5XKK8 Q8IXY2
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

AA Sequence

MSSESEKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVKNNSYIKDFFEQMLKIFKEM      1 - 70
QSVVDARHDKIQKESLCSKVAMAMCSVVQKSTNVEELHQSAKEVFKSAHTPVIISVLNSSNILGSLESSL     71 - 140
SHLMKFPIMNLQLSDFYTEDTKEQSDVTTSERTRSPPGSSKTTMIDTLKKLQDVLKTEDSKNPTKSAADL    141 - 210
LEQIVKAMGPILEILQKAIKTMEMNISVFKKASDK                                       211 - 245
//

Text Mined References (4)

PMID Year Title
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.