Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.04
PubTator Score 0.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q5U649 A8K1M7 Q5XKK8 Q8IXY2
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MSSESEKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVKNNSYIKDFFEQMLKIFKEM      1 - 70
QSVVDARHDKIQKESLCSKVAMAMCSVVQKSTNVEELHQSAKEVFKSAHTPVIISVLNSSNILGSLESSL     71 - 140
SHLMKFPIMNLQLSDFYTEDTKEQSDVTTSERTRSPPGSSKTTMIDTLKKLQDVLKTEDSKNPTKSAADL    141 - 210
LEQIVKAMGPILEILQKAIKTMEMNISVFKKASDK                                       211 - 245
//

Text Mined References (4)

PMID Year Title
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.