Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.69
PubTator Score 0.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.002
ependymoma -1.300 0.017
oligodendroglioma -1.600 0.003
cutaneous lupus erythematosus 1.100 0.036
psoriasis -1.200 0.012
osteosarcoma -2.070 0.000
glioblastoma -1.100 0.000
adrenocortical carcinoma -1.188 0.020
pancreatic ductal adenocarcinoma liver m... -1.104 0.002
tuberculosis and treatment for 6 months 1.200 0.000
lung cancer -3.200 0.000
interstitial cystitis -1.700 0.000
ovarian cancer -2.000 0.000
pituitary cancer -1.100 0.031

Gene RIF (2)

PMID Text
20195266 Clinical trial and genome-wide association study of gene-disease association. (HuGE Navigator)
15691849 These data suggest that MBD1.MCAF1.SETDB1 complex facilitates the formation of heterochromatic domains, emphasizing the role of MCAF/AM family proteins in epigenetic control, and describe a new family member, MCAF2 (ATF7IP2).

AA Sequence

MASPDRSKRKILKAKKTMPLSCRKQVEMLNKSRNVEALKTAIGSNVPSGNQSFSPSVITRTTEITKCSPS      1 - 70
ENGASSLDSNKNSISEKSKVFSQNCIKPVEEIVHSETKLEQVVCSYQKPSRTTESPSRVFTEEAKDSLNT     71 - 140
SENDSEHQTNVTRSLFEHEGACSLKSSCCPPSVLSGVVQMPESTVTSTVGDKKTDQMVFHLETNSNSESH    141 - 210
DKRQSDNILCSEDSGFVPVEKTPNLVNSVTSNNCADDILKTDECSRTSISNCESADSTWQSSLDTNNNSH    211 - 280
YQKKRMFSENEENVKRMKTSEQINENICVSLERQTAFLEQVRHLIQQEIYSINYELFDKKLKELNQRIGK    281 - 350
TECRNKHEGIADKLLAKIAKLQRRIKTVLLFQRNCLKPNMLSSNGASKVANSEAMILDKNLESVNSPIEK    351 - 420
SSVNYEPSNPSEKGSKKINLSSDQNKSVSESNNDDVMLISVESPNLTTPITSNPTDTRKITSGNSSNSPN    421 - 490
AEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPP    491 - 560
APLPELVDKTRDTLPPQKPELKVKRVFRPNGIALTWNITKINPKCAPVESYHLFLCHENSNNKLIWKKIG    561 - 630
EIKALPLPMACTLSQFLASNRYYFTVQSKDIFGRYGPFCDIKSIPGFSENLT                      631 - 682
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15691849 2005 Transcriptional repression and heterochromatin formation by MBD1 and MCAF/AM family proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.