Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.69
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.00218953795032E-8
interstitial cystitis 2299 1.08394820122523E-5
tuberculosis and treatment for 6 months 686 1.40549186768343E-5
lung cancer 4473 1.47688112368332E-5
osteosarcoma 7933 5.30860674381715E-5
glioblastoma 5572 4.42564027339983E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00185559977684953
astrocytic glioma 2241 0.00242363072905512
oligodendroglioma 2849 0.00315745834890054
psoriasis 6685 0.0123632889217121
ependymoma 2514 0.0173829881343426
adrenocortical carcinoma 1427 0.0195540351343591
pituitary cancer 1972 0.0310298149587746
cutaneous lupus erythematosus 1056 0.0358868861643923

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.002
ependymoma -1.300 0.017
oligodendroglioma -1.600 0.003
cutaneous lupus erythematosus 1.100 0.036
psoriasis -1.200 0.012
osteosarcoma -2.070 0.000
glioblastoma -1.100 0.000
adrenocortical carcinoma -1.188 0.020
pancreatic ductal adenocarcinoma liver m... -1.104 0.002
tuberculosis and treatment for 6 months 1.200 0.000
lung cancer -3.200 0.000
interstitial cystitis -1.700 0.000
ovarian cancer -2.000 0.000
pituitary cancer -1.100 0.031

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
20195266 Clinical trial and genome-wide association study of gene-disease association. (HuGE Navigator)
15691849 These data suggest that MBD1.MCAF1.SETDB1 complex facilitates the formation of heterochromatic domains, emphasizing the role of MCAF/AM family proteins in epigenetic control, and describe a new family member, MCAF2 (ATF7IP2).

AA Sequence

MASPDRSKRKILKAKKTMPLSCRKQVEMLNKSRNVEALKTAIGSNVPSGNQSFSPSVITRTTEITKCSPS      1 - 70
ENGASSLDSNKNSISEKSKVFSQNCIKPVEEIVHSETKLEQVVCSYQKPSRTTESPSRVFTEEAKDSLNT     71 - 140
SENDSEHQTNVTRSLFEHEGACSLKSSCCPPSVLSGVVQMPESTVTSTVGDKKTDQMVFHLETNSNSESH    141 - 210
DKRQSDNILCSEDSGFVPVEKTPNLVNSVTSNNCADDILKTDECSRTSISNCESADSTWQSSLDTNNNSH    211 - 280
YQKKRMFSENEENVKRMKTSEQINENICVSLERQTAFLEQVRHLIQQEIYSINYELFDKKLKELNQRIGK    281 - 350
TECRNKHEGIADKLLAKIAKLQRRIKTVLLFQRNCLKPNMLSSNGASKVANSEAMILDKNLESVNSPIEK    351 - 420
SSVNYEPSNPSEKGSKKINLSSDQNKSVSESNNDDVMLISVESPNLTTPITSNPTDTRKITSGNSSNSPN    421 - 490
AEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPP    491 - 560
APLPELVDKTRDTLPPQKPELKVKRVFRPNGIALTWNITKINPKCAPVESYHLFLCHENSNNKLIWKKIG    561 - 630
EIKALPLPMACTLSQFLASNRYYFTVQSKDIFGRYGPFCDIKSIPGFSENLT                      631 - 682
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15691849 2005 Transcriptional repression and heterochromatin formation by MBD1 and MCAF/AM family proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.