Property Summary

NCBI Gene PubMed Count 11
PubMed Score 131.32
PubTator Score 114.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group B ependymoma 4.100 0.000
atypical teratoid/rhabdoid tumor 1.800 0.000
active Crohn's disease -1.166 0.034
adult high grade glioma 1.100 0.001
nasopharyngeal carcinoma -1.600 0.002
Endometriosis -1.278 0.023
ovarian cancer -1.700 0.000
chronic rhinosinusitis -1.947 0.022

Synonym

Accession Q5U5Z8 A8MPX2 Q53FV5 Q8IV57 Q9H5C0
Symbols CCP2

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
25916089 Suggest role for AGBL2 in cell proliferation and chemotherapy resistance in gastric cancer.
24884516 High AGBL2 expression is associated with breast cancer.
21303978 RARRES1, its interacting partners AGBL2, Eg5/KIF11, another EEY-bearing protein (EB1), and the microtubule tyrosination cycle are important in tumorigenesis.

AA Sequence

MFPALETHLKQTIPDPYEDFMYRHLQYYGYFKAQRGSLPNSATHQHVRKNNPQCLLNGSLGEKDDLIPDT      1 - 70
LQKEKLLWPISLSSAVHRQIEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPASAFRVAGITDSHMLSL     71 - 140
PHLRSRQLLYDELDEVNPRLREPQELFSILSTKRPLQAPRWPIECEVIKENIHHIEWAPPQPEYFYQPKG    141 - 210
NEKVPEIVGEKKGTVVYQLDSVPIEGSYFTSSRVGGKRGIVKELAVTLQGPEDNTLLFESRFESGNLQKA    211 - 280
VRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRN    281 - 350
IGWRREGNEIKYYKNNTDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFC    351 - 420
KLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLR    421 - 490
DIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEEREVLLYCDFHGH    491 - 560
SRKNNIFLYGCNNNNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILNSYTME    561 - 630
STFGGSTLGNKRDTHFTIEDLKSLGYHVCDTLLDFCDPDQMKFTQCLAELKELLRQEIHKKFHELGQDVD    631 - 700
LEGSWSDISLSDIESSTSGSDSSLSDGLPVHLANIADELTQKKKMFKKKKKKSLQTRKQRNEQYQKKNLM    701 - 770
QKLKLTEDTSEKAGFASTLQKQPTFFKNSENSSFLPMKNENPRLNETNLNRRDKDTPLDPSMATLILPKN    771 - 840
KGRMQNKKPGFTVSCSPKRTINSSQEPAPGMKPNWPRSRYPATKRGCAAMAAYPSLHIYTYP            841 - 902
//

Text Mined References (12)

PMID Year Title
25916089 Effects of AGBL2 on cell proliferation and chemotherapy resistance of gastric cancer.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
24884516 2014 Clinical implications of AGBL2 expression and its inhibitor latexin in breast cancer.
23085998 2013 Functional segregation and emerging role of cilia-related cytosolic carboxypeptidases (CCPs).
21303978 2011 Tumor suppressor RARRES1 interacts with cytoplasmic carboxypeptidase AGBL2 to regulate the ?-tubulin tyrosination cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12738998 2003 Identification of candidate liver tumor suppressor genes from human 11p11.2 by transcription mapping of microcell hybrid cell lines.
More...