Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 4.7e-02
atypical teratoid/rhabdoid tumor -1.500 8.3e-05
ependymoma -1.500 3.6e-06
subependymal giant cell astrocytoma -2.043 3.2e-03

AA Sequence

MLACLQRTQNAPGQHLACPSKSLELRKCEAVASAMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVP      1 - 70
QHKHLSRTVNGYDTSGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAA     71 - 140
VQVGIAPYPVPSTLGPLAYPKPPEAPAPPPGLPAAATAASVIPLPGRGLPLPPSNLPSIHSLLYQLNQQC    141 - 210
QAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYAD    211 - 280
SGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWN    281 - 350
SVLVTPTSDCYNPAAAVVVTELGPGAARELAGPPADALSGLPSKSVCNTSVLSSSLQSLEYLINDIRPPC    351 - 420
IKEQMLGKGYETVAVPRLLDHQHAHIRLPVYR                                          421 - 452
//

Text Mined References (4)

PMID Year Title