Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.55
PubTator Score 5.51

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -1.208 3.2e-02
adult high grade glioma -1.100 8.7e-03
aldosterone-producing adenoma -1.032 7.9e-03
astrocytic glioma -1.200 4.5e-02
atypical teratoid / rhabdoid tumor -1.700 6.4e-06
cystic fibrosis -1.100 3.7e-05
glioblastoma -1.500 8.4e-05
invasive ductal carcinoma -1.200 1.5e-03
medulloblastoma -1.200 1.7e-04
medulloblastoma, large-cell -1.100 4.0e-04
non primary Sjogren syndrome sicca -1.200 2.1e-02
osteosarcoma 1.613 8.3e-05
pancreatic ductal adenocarcinoma liver m... -1.497 8.7e-03

Gene RIF (4)

AA Sequence

IQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ                                         71 - 104

Text Mined References (14)

PMID Year Title