Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.23
PubTator Score 5.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 6.43466886574903E-6
cystic fibrosis 1670 3.70917866573896E-5
osteosarcoma 7933 8.27395278302304E-5
glioblastoma 5572 8.36884593140978E-5
medulloblastoma 1524 1.72983742830983E-4
pediatric high grade glioma 2712 2.61269314165142E-4
invasive ductal carcinoma 2950 0.00151564984740131
medulloblastoma, large-cell 6234 0.0029298037315428
aldosterone-producing adenoma 664 0.00785314085653523
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00868275746085528
active ulcerative colitis 477 0.0162404335812248
non primary Sjogren syndrome sicca 840 0.0207991752989953
astrocytic glioma 2241 0.0449030733966178
Disease Target Count Z-score Confidence
Lactic acidosis 43 3.101 1.6

Expression

  Differential Expression (13)

Synonym

Accession Q5U5X0 A8MPQ9 Q86Y68
Symbols MZM1L
MC3DN8
C5orf31

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26912632 In multifocal cavitating leukoencephalopathy patients, LYRm7 mutations were identified associated with distinct MRI appearances.
24014394 LYRM7/MZM1L is a novel disease gene, causing cIII-defective, early onset, severe mitochondrial encephalopathy.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSV      1 - 70
IQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ                                         71 - 104
//

Text Mined References (13)

PMID Year Title
26912632 2016 LYRM7 mutations cause a multifocal cavitating leukoencephalopathy with distinct MRI appearance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24606901 2014 Cochaperone binding to LYR motifs confers specificity of iron sulfur cluster delivery.
24014394 2013 A homozygous mutation in LYRM7/MZM1L associated with early onset encephalopathy, lactic acidosis, and severe reduction of mitochondrial complex III activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23168492 2013 LYRM7/MZM1L is a UQCRFS1 chaperone involved in the last steps of mitochondrial Complex III assembly in human cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...