Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.23
PubTator Score 5.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (4)

PMID Text
26912632 In multifocal cavitating leukoencephalopathy patients, LYRm7 mutations were identified associated with distinct MRI appearances.
24014394 LYRM7/MZM1L is a novel disease gene, causing cIII-defective, early onset, severe mitochondrial encephalopathy.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSV      1 - 70
IQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ                                         71 - 104
//

Text Mined References (13)

PMID Year Title
26912632 2016 LYRM7 mutations cause a multifocal cavitating leukoencephalopathy with distinct MRI appearance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24606901 2014 Cochaperone binding to LYR motifs confers specificity of iron sulfur cluster delivery.
24014394 2013 A homozygous mutation in LYRM7/MZM1L associated with early onset encephalopathy, lactic acidosis, and severe reduction of mitochondrial complex III activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23168492 2013 LYRM7/MZM1L is a UQCRFS1 chaperone involved in the last steps of mitochondrial Complex III assembly in human cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...