Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma -1.400 1.6e-04
medulloblastoma, large-cell -2.000 3.9e-04
X-linked cerebral adrenoleukodystrophy 1.400 4.3e-02
Pick disease -1.300 2.0e-03
Breast cancer -1.500 2.0e-07

 MGI Phenotype (1)

Gene RIF (5)

PMID Text
23770851 A major biological consequence of upregulation of miR-221 is reprogramming of androgen receptor signaling via downregulation of HECTD2 and RAB1A.
21335971 HECTD2 polymorphisms are not associated with genetic susceptibility to sporadic Creutzfeldt-Jakob disease in a Korean population
19754925 The common haplotypes of HECTD2, tagged by rs12249854, are not associated with susceptibility to late onset Alzheimer's disease
19214206 HECTD2 haplotypes are associated with the susceptibility to human prion diseases.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEAVRVPSPATPLVVAAPAPEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKK      1 - 70
EAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVE     71 - 140
KVKSSGDWKAVHDFYLTTFDSFPELNAAFKKDATASFNTIEDSGINAKFVNAVYDTLLNTPQDVQKTVLK    141 - 210
GIINSLLREWKGPRTKDDLRAYFILLQNPQFNNTSTYVIYAHLLRQIATLVEADHHFLVHWFKKLSQKRF    211 - 280
KQLVERLLQFISLRLFPAKPEEFPPITKCSWWIPSAAKVLALLNTANNLVHPPLIPYTDFYNSTLDHIDL    281 - 350
MEEYHTWQNFGNSHRFSFCQYPFVISVAAKKIIIQRDSEQQMINIARQSLVDKVSRRQRPDMNILFLNMK    351 - 420
VRRTHLVSDSLDELTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKDSHCHW    421 - 490
FSSFKCDNYSEFRLVGILMGLAVYNSITLDIRFPPCCYKKLLSPPIIPSDQNIPVGICNVTVDDLCQIMP    491 - 560
ELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKISVTNQNRKEYVQLYTDFLLNKSIY    561 - 630
KQFAAFYYGFHSVCASNALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLGFPL    631 - 700
DLQKKLLHFTTGSDRVPVGGMADLNFKISKNETSTNCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNS    701 - 770
EGFGLE                                                                    771 - 776
//

Text Mined References (15)

PMID Year Title
23770851 2014 MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A.
21335971 2011 Absence of association between two HECTD2 polymorphisms and sporadic Creutzfeldt-Jakob disease.
19754925 2009 HECTD2, a candidate susceptibility gene for Alzheimer's disease on 10q.
19214206 2009 HECTD2 is associated with susceptibility to mouse and human prion disease.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11597177 2001 Identification and initial characterization of 5000 expressed sequenced tags (ESTs) each from adult human normal and osteoarthritic cartilage cDNA libraries.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.