Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.91
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma 1.800 1.6e-02
atypical teratoid / rhabdoid tumor 1.800 1.2e-04
Chronic Lymphocytic Leukemia 1.455 2.3e-03
ependymoma 1.500 3.2e-02
glioblastoma 1.200 3.0e-05
group 4 medulloblastoma 1.800 1.9e-04
hepatocellular carcinoma -1.700 5.1e-03
medulloblastoma, large-cell 1.100 1.5e-05
Multiple myeloma 1.387 2.6e-02
non primary Sjogren syndrome sicca -1.400 2.5e-02
oligodendroglioma 1.400 2.1e-02
osteosarcoma 2.059 8.3e-08
ovarian cancer 1.100 1.2e-07
pancreatic cancer -1.600 1.7e-03
pancreatic carcinoma -1.600 1.7e-03
pediatric high grade glioma 1.500 1.5e-05
primitive neuroectodermal tumor 1.200 2.9e-05
Rheumatoid arthritis 1.600 1.4e-03
sarcoidosis 1.100 3.6e-03
tuberculosis 2.400 4.4e-05

Gene RIF (5)

AA Sequence

MPSGSSAALALAAAPAPLPQPPPPPPPPPPPLPPPSGGPELEGDGLLLRERLAALGLDDPSPAEPGAPAL      1 - 70
RAPAAAAQGQARRAAELSPEERAPPGRPGAPEAAELELEEDEEEGEEAELDGDLLEEEELEEAEEEDRSS     71 - 140
LLLLSPPAATASQTQQIPGGSLGSVLLPAARFDAREAAAAAAAAGVLYGGDDAQGMMAAMLSHAYGPGGC    141 - 210
GAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVT    211 - 280
GRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIK    281 - 350
RIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGT    351 - 420
LGSAWLSSNPVPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSE    421 - 490
DLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRV    491 - 560
RSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENEVIAALVPCGHNLFCM    561 - 630
ECANKICEKRTPSCPVCQTAVTQAIQIHS                                             631 - 659
//

Text Mined References (19)

PMID Year Title