Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.51
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession Q5U5Q3 A1L022 Q9NZE3
Symbols RKHD2
BM-013
MEX-3C
RNF194

Gene

Gene RIF (4)

PMID Text
26471122 associates with cytoplasmic deadenylation complexes and ubiquitinates CNOT7
22863774 The RNA-binding E3 ubiquitin ligase MEX-3C links ubiquitination with MHC-I mRNA degradation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17015768 In combination sibling-pair linkage analysis and case-control association studies of chromosome 18, RKHD2 is found to contribute to the genetic susceptibility of essential hypertension.

AA Sequence

MPSGSSAALALAAAPAPLPQPPPPPPPPPPPLPPPSGGPELEGDGLLLRERLAALGLDDPSPAEPGAPAL      1 - 70
RAPAAAAQGQARRAAELSPEERAPPGRPGAPEAAELELEEDEEEGEEAELDGDLLEEEELEEAEEEDRSS     71 - 140
LLLLSPPAATASQTQQIPGGSLGSVLLPAARFDAREAAAAAAAAGVLYGGDDAQGMMAAMLSHAYGPGGC    141 - 210
GAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVT    211 - 280
GRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIK    281 - 350
RIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGT    351 - 420
LGSAWLSSNPVPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSE    421 - 490
DLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRV    491 - 560
RSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENEVIAALVPCGHNLFCM    561 - 630
ECANKICEKRTPSCPVCQTAVTQAIQIHS                                             631 - 659
//

Text Mined References (18)

PMID Year Title
26471122 2015 A non-proteolytic role for ubiquitin in deadenylation of MHC-I mRNA by the RNA-binding E3-ligase MEX-3C.
23446422 2013 Replication stress links structural and numerical cancer chromosomal instability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22863774 2012 The RNA-binding E3 ubiquitin ligase MEX-3C links ubiquitination with MHC-I mRNA degradation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...