Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.300 1.2e-06
astrocytic glioma -2.200 2.9e-03
Astrocytoma, Pilocytic -2.800 1.7e-09
atypical teratoid / rhabdoid tumor -3.700 9.1e-12
ependymoma -2.600 9.8e-03
glioblastoma -2.300 3.1e-09
lung adenocarcinoma 2.100 8.4e-08
lung carcinoma 1.600 2.1e-35
medulloblastoma -1.100 1.4e-02
oligodendroglioma -1.400 4.0e-02
osteosarcoma 1.423 1.9e-04
primitive neuroectodermal tumor -2.100 1.1e-03
psoriasis 1.100 3.7e-20
subependymal giant cell astrocytoma -2.222 1.7e-02

AA Sequence

MKEGRGSFSVERGPRKERETAQSGMWKGNSPAGSQGAAMEGTGGELGGQGNWGPEDAPGLLARASLIMLP      1 - 70
WPLPLASSALTLLFGALTSLFLWYCYRLGSQDMQALGAGSRAGGVRGGPVGCSEAGGPSPGGPGDPGEGP     71 - 140
RTEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGPGRGPGVLGIQRPGLLFLPDLPSAPFVPRDAQRHDV    141 - 210
ELLESSFPAILRDFGAVSWDFSGTTPPPRGWSPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALRGLRS    211 - 280
FMSANTFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPPGCELVVGGEPQCWAEGHCLLVDDSFLHT    281 - 350
VAHNGSPEDGPRVVFIVDLWHPNVAGAERQALDFVFAPDP                                  351 - 390
//

Text Mined References (8)

PMID Year Title