Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.06536094050986E-35
psoriasis 6685 3.66555250972084E-20
posterior fossa group B ependymoma 1530 6.9252882515711E-20
atypical teratoid / rhabdoid tumor 4369 9.09924000703233E-12
pilocytic astrocytoma 3086 7.47285385296928E-9
lung adenocarcinoma 2714 8.38845670753655E-8
pediatric high grade glioma 2712 4.24929084099822E-7
glioblastoma 5572 1.07534723636057E-5
osteosarcoma 7933 1.90024571792251E-4
primitive neuroectodermal tumor 3031 0.00113442384826963
astrocytic glioma 2241 0.00288219344309723
medulloblastoma 1524 0.0142517063362846
subependymal giant cell astrocytoma 2287 0.0172460602843739
oligodendroglioma 2849 0.0399770350451341

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.200 0.003
posterior fossa group B ependymoma -4.000 0.000
oligodendroglioma -1.400 0.040
glioblastoma -2.500 0.000
osteosarcoma 1.423 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma -1.100 0.014
primitive neuroectodermal tumor -2.100 0.001
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -2.800 0.000
subependymal giant cell astrocytoma -2.222 0.017
lung adenocarcinoma 2.100 0.000
lung carcinoma 1.600 0.000
psoriasis 1.100 0.000

Synonym

Accession Q5U4P2 A0AVE3 B7ZLZ3 Q8IW63 Q8N316 Q96H00
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

MKEGRGSFSVERGPRKERETAQSGMWKGNSPAGSQGAAMEGTGGELGGQGNWGPEDAPGLLARASLIMLP      1 - 70
WPLPLASSALTLLFGALTSLFLWYCYRLGSQDMQALGAGSRAGGVRGGPVGCSEAGGPSPGGPGDPGEGP     71 - 140
RTEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGPGRGPGVLGIQRPGLLFLPDLPSAPFVPRDAQRHDV    141 - 210
ELLESSFPAILRDFGAVSWDFSGTTPPPRGWSPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALRGLRS    211 - 280
FMSANTFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPPGCELVVGGEPQCWAEGHCLLVDDSFLHT    281 - 350
VAHNGSPEDGPRVVFIVDLWHPNVAGAERQALDFVFAPDP                                  351 - 390
//

Text Mined References (8)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.