Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.07
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
osteosarcoma -1.905 0.000
tuberculosis 1.600 0.000
intraductal papillary-mucinous carcinoma... 1.300 0.001
intraductal papillary-mucinous neoplasm ... 1.700 0.001
lung cancer -2.600 0.000
group 4 medulloblastoma 1.400 0.000
lung carcinoma 1.700 0.000

AA Sequence

MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLEILVALRHILRQTKEDGRG      1 - 70
SPGSQPEQVTQRPEEGKESLSKNLLLVALCLTFGVEVGFKFATKTVIYLLNPCHLVTMMHIFLLACPPCR     71 - 140
GAIVVFKLQMHMLNGALLALLFPVVNTRLLPFELEIYYIQHVMLYVVPIYLLWKGGAYTPEPLSSFRWAL    141 - 210
LSTGLMFFYHFSVLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLMTMTHGKLVILFSYMAGP    211 - 280
LCKYLLDLLRLPAKKID                                                         281 - 297
//

Text Mined References (8)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.