Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.07
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 4 medulloblastoma 1.400 3.3e-04
intraductal papillary-mucinous carcinoma... 1.300 5.8e-04
intraductal papillary-mucinous neoplasm ... 1.700 5.7e-04
lung cancer -1.900 8.8e-05
lung carcinoma 1.700 3.8e-25
malignant mesothelioma -1.400 5.8e-07
osteosarcoma -1.216 2.2e-03
tuberculosis 1.400 6.4e-08

AA Sequence

MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLEILVALRHILRQTKEDGRG      1 - 70
SPGSQPEQVTQRPEEGKESLSKNLLLVALCLTFGVEVGFKFATKTVIYLLNPCHLVTMMHIFLLACPPCR     71 - 140
GAIVVFKLQMHMLNGALLALLFPVVNTRLLPFELEIYYIQHVMLYVVPIYLLWKGGAYTPEPLSSFRWAL    141 - 210
LSTGLMFFYHFSVLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLMTMTHGKLVILFSYMAGP    211 - 280
LCKYLLDLLRLPAKKID                                                         281 - 297
//

Text Mined References (8)

PMID Year Title