Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
R01 Count 5
Funding $878,175
PubMed Score 20.33
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.300 0.006
ovarian cancer 1.400 0.000

Synonym

Accession Q5TZA2 Q2VHY3 Q66GT7 Q7Z2L4 Q7Z5D7
Symbols ROLT
TAX1BP2

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
24240686 Data show that serine-922 of TAX1BP2 protein is the phosphorylation site of ataxia telangiectasia mutated (ATM) kinase.
23070519 C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis.
22610972 we demonstrated that TAX1BP2 was frequently underexpressed in hepatocellular carcinoma (HCC) and that loss of TAX1BP2 promoted the growth of HCC cells by suppressing activation of the p38/p53/p21 pathway.
16767081 Our findings suggest that the HTLV-I Tax oncoprotein targets TAX1BP2 causing genomic instability and aneuploidy.

AA Sequence

MSLGLARAQEVELTLETVIQTLESSVLCQEKGLGARDLAQDAQITSLPALIREIVTRNLSQPESPVLLPA      1 - 70
TEMASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVSERLEQALRLEPGELETQEPRGLVRQ     71 - 140
SVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKILQYKKRCSELEQQLLERSGELEQQRLRDTE    141 - 210
HSQDLESALIRLEEEQQRSASLAQVNAMLREQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRR    211 - 280
EEESFNAYFSNEHSRLLLLWRQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAE    281 - 350
SRAEAALEKQALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVN    351 - 420
KDLTEKLEALESLRLQEQAALETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADASNGSLRGLSGQ    421 - 490
RTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRGRYEASQDLLGTLRKQLSDSE    491 - 560
SERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANELLSREKSNLAHSLQVAQQQAEELRQEREKLQ    561 - 630
AAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQ    631 - 700
AEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQ    701 - 770
GRQRQAEQEATVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLS    771 - 840
RQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEATRLRLEKEALE    841 - 910
GSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQEKASLDKELMAQKLVQAEREA    911 - 980
QASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQLQREQEELLARLEAEKEELSEEIAALQQERD    981 - 1050
EGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDL   1051 - 1120
RAQREEAAAAHAQEVRRLQEQARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEG   1121 - 1190
REVQRQEAGELRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKE   1191 - 1260
AGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKESRRETLGLRQR   1261 - 1330
LLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQLDHARGLELKLEAARAEAAE   1331 - 1400
LGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSALRRGLGLGRAPSPAPRPVPGSPARDAPAEGS   1401 - 1470
GEGLNSPSTLECSPGSQPPSPGPATSPASPDLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLA   1471 - 1540
EMEAERDSATSRARQLQKAVAESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQ   1541 - 1610
ATESELRASQEKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQ   1611 - 1680
ALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSASLNSTRDKNL   1681 - 1750
HLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVADLELQRVEAEGQLQQLREVLR   1751 - 1820
QRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAEKREVERSALRLEKDRVALRRTLDKVEREKL   1821 - 1890
RSHEDTVRLSAEKGRLDRTLTGAELELAEAQRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVER   1891 - 1960
LRSAQAQTERTLEARERAHRQRVRGLEEQVSTLKGQLQQELRRSSAPFSPPSGPPEK                1961 - 2017
//

Text Mined References (23)

PMID Year Title
27623382 2016 A Conserved Role for Girdin in Basal Body Positioning and Ciliogenesis.
24554434 2014 Centlein mediates an interaction between C-Nap1 and Cep68 to maintain centrosome cohesion.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240686 2014 The tumor suppressor, TAX1BP2, is a novel substrate of ATM kinase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23070519 2012 C-NAP1 and rootletin restrain DNA damage-induced centriole splitting and facilitate ciliogenesis.
22610972 2012 The centrosomal protein Tax1 binding protein 2 is a novel tumor suppressor in hepatocellular carcinoma regulated by cyclin-dependent kinase 2.
22036096 2011 A genome-wide meta-analysis of genetic variants associated with allergic rhinitis and grass sensitization and their interaction with birth order.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...