Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (72)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
lung cancer 4607 0.0 0.5

AA Sequence

VTPLLNPIIYTLRNKDVKGALRTLILGSAAGQSHKD                                      281 - 316

Text Mined References (3)

PMID Year Title