Property Summary

NCBI Gene PubMed Count 29
PubMed Score 83.17
PubTator Score 63.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.6e-05
medulloblastoma, large-cell 6241 1.8e-04
Breast cancer 3578 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 3.100 2.6e-02
group 3 medulloblastoma 1.500 2.6e-05
medulloblastoma, large-cell 1.400 1.8e-04

Protein-protein Interaction (8)

Gene RIF (13)

AA Sequence

MAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDR      1 - 70
QINTRSPKRNQRVAMVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDN     71 - 140
DFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFK    141 - 210
DLPDEIPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETM    211 - 280
PIAAFGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLIQVTRLS    281 - 350
KILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQ    351 - 420
GLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKS    421 - 490
LTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAFAANNTNRD                      491 - 542
//

Text Mined References (38)

PMID Year Title