Property Summary

NCBI Gene PubMed Count 27
PubMed Score 79.33
PubTator Score 63.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 2.6175763546819E-5
medulloblastoma, large-cell 6234 1.82246760663211E-4
Breast cancer 3099 0.0260219833290876
Disease Target Count Z-score Confidence
Retinoblastoma 14 3.228 1.6
Complex regional pain syndrome 12 3.033 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.400 0.000
Breast cancer 3.100 0.026

Synonym

Accession Q5TKA1 Q5U5L8 Q5U7E1 Q6PI55 Q6ZTV4 Q7Z3J1 HuLin-9
Symbols TGS
BARA
TGS1
TGS2
Lin-9
BARPsv

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (11)

PMID Text
24475316 LIN-9 phosphorylation on threonine-96 is required for transcriptional activation of LIN-9 target genes and promotes cell cycle progression.
24141769 Results show that E7 interacts with the B-Myb, FoxM1 and LIN9 components of this activator complex, leading to cooperative transcriptional activation of mitotic genes in primary cells and E7 recruitment to the corresponding promoters.
23381944 Study links hTRM9L and tRNA modifications to inhibition of tumour growth via LIN9 and HIF1-alpha-dependent mechanisms.
21860417 inactivation of LIN9, a subunit of DREAM, results in premature senescence, which can be overcome by the SV40 large T (LT) antigen
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360844 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17563750 The repressor complex that Mip/LIN-9 forms with p107 takes functional precedence over the transcriptional activation linked to the Mip/LIN-9 and B-Myb interaction.
17159899 human LIN-9, together with B-MYB, has a critical role in the activation of genes that are essential for progression into mitosis
17098733 Mip/LIN-9 is required for the expression of B-Myb, and both proteins collaborate in the control of the cell cycle progression via the regulation of S phase and cyclin A, cyclin B, and CDK1
16730350 Mutation of BARA/LIN-9 restores the expression of E2F target genes.
More...

AA Sequence

MAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDR      1 - 70
QINTRSPKRNQRVAMVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDN     71 - 140
DFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFK    141 - 210
DLPDEIPLPLVIGTKVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETM    211 - 280
PIAAFGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLIQVTRLS    281 - 350
KILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQ    351 - 420
GLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEGGDLNSFEFKS    421 - 490
LTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAFAANNTNRD                      491 - 542
//

Text Mined References (35)

PMID Year Title
24475316 2014 LIN-9 phosphorylation on threonine-96 is required for transcriptional activation of LIN-9 target genes and promotes cell cycle progression.
24141769 2014 A functional interaction of E7 with B-Myb-MuvB complex promotes acute cooperative transcriptional activation of both S- and M-phase genes. (129 c).
23667535 2013 LIN9, a subunit of the DREAM complex, regulates mitotic gene expression and proliferation of embryonic stem cells.
23381944 2013 A human tRNA methyltransferase 9-like protein prevents tumour growth by regulating LIN9 and HIF1-?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22391450 2012 The MuvB complex sequentially recruits B-Myb and FoxM1 to promote mitotic gene expression.
22037783 2012 Prognostic impact of polymorphisms in the MYBL2 interacting genes in breast cancer.
21860417 2012 Loss of LIN9, a member of the DREAM complex, cooperates with SV40 large T antigen to induce genomic instability and anchorage-independent growth.
21498570 2011 DYRK1A protein kinase promotes quiescence and senescence through DREAM complex assembly.
21480327 2011 Activation of v-Myb avian myeloblastosis viral oncogene homolog-like2 (MYBL2)-LIN9 complex contributes to human hepatocarcinogenesis and identifies a subset of hepatocellular carcinoma with mutant p53.
More...