Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPGLLNWITGAALPLTASDVTSCVSGYALGLTASLTYGNLEAQPFQGLFVYPLDECTTVIGFEAVIADRV      1 - 70
VTVQIKDKAKLESGHFDASHVRSPTVTGNILQDGVSIAPHSCTPGKVTLDEDLERILFVANLGTIAPMEN     71 - 140
VTIFISTSSELPTLPSGAVRVLLPAVCAPTVPQFCTKSTGTSNQQAQGKDRHCFGAWAPGSWNKLCLATL    141 - 210
LNTEVSNPMEYEFNFQLEIRGPCLLAGVESPTHEIRADAAPSARSAKSIIITLANKHTFDRPVEILIHPS    211 - 280
EPHMPHVLIEKGDMTLGEFDQHLKGRTDFIKGMKKKSRAERKTEIIRKRLHKDIPHHSVIMLNFCPDLQS    281 - 350
VQPCLRKAHGEFIFLIDRSSSMSGISMHRVKDAMLVALKSLMPACLFNIIGFGSTFKSLFPSSQTYSEDS    351 - 420
LAMACDDIQRMKADMGGTNILSPLKWVIRQPVHRGHPRLLFVITDGAVNNTGKVLELVRNHAFSTRCYSF    421 - 490
GIGPNVCHRLVKGLASVSEGSAELLMEGERLQPKMVKSLKKAMAPVLSDVTVEWIFPETTEVLVSPVSAS    491 - 560
SLFPGERLVGYGIVCDASLHISNPRSDKRRRYSMLHSQESGSSVFYHSQDDGPGLEGGDCAKNSGAPFIL    561 - 630
GQAKNARLASGDSTTKHDLNLSQRRRAYSTNQITNHKPLPRATMASDPMPAAKRYPLRKARLQDLTNQTS    631 - 700
LDVQRWQIDLQPLLNSGQDLNQGPKLRGPGARRPSLLPQGCQPFLPWGQETQAWSPVRERTSDSRSPGDL    701 - 770
EPSHHPSAFETETSSDWDPPAESQERASPSRPATPAPVLGKALVKGLHDSQRLQWEVSFELGTPGPERGG    771 - 840
AQDADLWSETFHHLAARAIIRDFEQLAEREGEIEQGSNRRYQVSALHTSKACNIISKYTAFVPVDVSKSR    841 - 910
YLPTVVEYPNSAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGNGKFQALNMEASPTALFSEARSP    911 - 980
GREKHGASEGPQRSLATNTLSSMKASENLFGSWLNLNKSRLLTRAAKGFLSKPLIKAVESTSGNQSFDYI    981 - 1050
PLVSLQLASGAFLLNEAFCEATHIPMEKLKWTSPFTCHRVSLTTRPSESKTPSPQLCTSSPPRHPSCDSF   1051 - 1120
SLEPLAKGKLGLEPRAVVEHTGKLWATVVGLAWLEHSSASYFTEWELVAAKANSWLEQQEVPEGRTQGTL   1121 - 1190
KAAARQLFVLLRHWDENLEFNMLCYNPNYV                                           1191 - 1220
//

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.