Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -1.166 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.003
ovarian cancer 1.600 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLSSGVETQPVPLDSSMSAVVQELYSELPVSVSRELHADPEPSVIPDVKPGASSSLLSQNRALPLELQRT      1 - 70
HVESCCEETYETLDHGSEPGRCGLVDSTAGGSVASGILDRAKRSESMEPKVFRDPGGQAGIIREPSEGAK     71 - 140
EDPHQHSTAAEEKTSPSQEDLLMQSSKELSHVDLPEDFLRSKEGNVQITAETLLKSAEVQGMKVNGTKTD    141 - 210
NNEGHKNGNVSKDLSAGCGEFQEVDKIMTSDEVSETSTLVTPEPLTFVDPVLTEATPKEKECEELKSCPW    211 - 280
LSLPGNSAISNVDNGKEELCKPNLVCEADDNHQQLHGHHNEQPSSTHDSPTATSPLKENSEVSCFTSDLS    281 - 350
GPESRTISLENCGFEGGGLLKRSAEKTDSSYFYRGDDQGKNLASREENEERLLIPRSERGGPFLFNAREP    351 - 420
EKEISGRCSGEKEPVVSPKENIHNNCIQDSLHTGNSSSLMPNSFTEATEVMLNKNDLKITVHVQGNLTNP    421 - 490
EDHKETFTNMSHPGGHSEESSFSSLMQIEEAGQTTPVEPNILSKSFYTKDCNSLVSIQRNLEGNTQLNEA    491 - 560
SCNDFLFERKSIVSLMPEDQISPVSEVLKPKQGTALLLPSPEFDYRPESEKVIQTSHDDIPLLDEQSIAC    561 - 630
EMNELSCTNELVVNKVESECVLNQQVSLNSQEHANLPTDSLLHLNKEMPLATGRDAHQSHHPPLEGRADV    631 - 700
IADIQTIPIQTKIKDISPPGNQTCGASSNCPTLNIKPVSLERKKEMADSGTKALHSRLRSNKREAAGFPQ    701 - 770
VVSVIECHSVQSQDISSCHRVRKNVSQENMCSASAAFKSSKISLQVDNSLITKYENAFQHRDHCCQGTGH    771 - 840
SVEKSSCKVSYTSQERELDGKETNGSLPGDKIRNKMVAGLLNSGISNKTIHTSSSIKLSEEGLEGKEQDV    841 - 910
SKETVFCKYNISDHAIQELNQTVNIPGPEKVLDQSPTVMFSSFKNVKSVETLDQKADEVLDCQSNQNRPD    911 - 980
ECKSEGQSAKEMLSSDQRETVTEPHGEVNHNQKDLLVSSGSNNSLPCGSPKKCNLKGAFVKMSGCDESTE    981 - 1050
GMVDIVYTDCSNKLAEGVLDVKASNLLDCGARQEKLAFQEDSRSTLSRRELDAAHTGTTGQDSDFPVTAA   1051 - 1120
STVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSL   1121 - 1190
RETQEMTEGSRLEPNSEFGKESTFGISSKESMSCHDESSVSLRSLKSIEIMPSQENSETNVNSEETDLKN   1191 - 1260
LCKPKDGEMLCENVKDCTVLPEMKEIVSRDWSNSSDRDSVCTCVEKNACKACHPHENSSDRHLPLTVKTD   1261 - 1330
IKVKGEETEEHQRGRLGYLTVGEQSEELVTRETGDGDPVSNISQTHFKCRGILNHAEKQQSPEVLDYMLQ   1331 - 1400
KEEKYIRQQKAHTISQQCISSSLLLDDAQNQNQPKADKDESTMINEITLAKLAKDSIVAQTQKLEDQKEE   1401 - 1470
RLHHPLRKDTESCTSPCLLGAPRKAQDPSSAGCDQIHGAFAKKGVLPLKKQPHRTCKKVSYQEQIIVGRK   1471 - 1540
IGKIRSSAFLKSSSNPIPTKAHRLLSLCTLSAPTRLEPETAPTKSLVSHIPKQMSTPCHPLRSLNFRKTT   1541 - 1610
KESALLNKLSILASKLAPAMKTQKLRYRRCSSELLPMAKSYKRLRYKRLLDGFSSSTEQLNPYLAASGWD   1611 - 1680
KRPNSKPMALYSLESIKMTFIDLSNKMPSLLFGSEIFPVSFHVKSSSSDCTTESSRTFPEHCAPARLALG   1681 - 1750
EALQCPSQPPKWTFSFFLSHGCPGMATFREDTGVHSQTHTQAPPQPPAPLQDYGGTAIVQTRADCSVLGL   1751 - 1820
HTLLALCSPGCYRIWTKKRSFSSHMPTMQRLFMTQFTQGLKGLRSPASIADKVFCSLPYSVGRVLSIWSQ   1821 - 1890
HGPSVCSFEISSLHSPHCKRQPSLGTTSSHTMLPYVPLPGMEATYNTSGSQTRLEPPFPALVPKSCLVAE   1891 - 1960
SAVSKLLLSASEFQVRGLDELDGVKAACPCPQSSPPEQKEAEPEKRPKKVSQIRIRKTIPRPDPNLTPMG   1961 - 2030
LPRPKRLKKKEFSLEEIYTNKNYKSPPANRCLETIFEEPKERNGTLISISQQKRKRVLEFQDFTVPRKRR   2031 - 2100
ARGKVKVAGSFTRAQKAAVQSRELDALLIQKLMELETFFAKEEEQEQSSGC                      2101 - 2151
//

Text Mined References (13)

PMID Year Title
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...