Property Summary

NCBI Gene PubMed Count 3
Grant Count 1
R01 Count 1
Funding $163,284
PubMed Score 6.12
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 0.002
oligodendroglioma -1.100 0.000
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.100 0.022
pediatric high grade glioma -1.700 0.000
pilocytic astrocytoma -1.200 0.000
sonic hedgehog group medulloblastoma -1.500 0.000
subependymal giant cell astrocytoma -1.320 0.016
ovarian cancer -1.300 0.000

Gene RIF (1)

PMID Text
23028632 MAPO2 gene product might positively contribute to the induction of apoptosis triggered by O-methylguanine

AA Sequence

MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFPHKKNDIPGPG      1 - 70
FYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFM     71 - 140
KALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSC    141 - 210
FKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGP    211 - 280
RKHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL                    281 - 334
//

Text Mined References (7)

PMID Year Title
23028632 2012 The identification of a novel gene, MAPO2, that is involved in the induction of apoptosis triggered by O?-methylguanine.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.