Property Summary

NCBI Gene PubMed Count 3
PubMed Score 7.12
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 2.5e-06
astrocytic glioma -1.400 2.1e-03
Astrocytoma, Pilocytic -1.200 3.8e-08
glioblastoma -1.500 3.6e-07
medulloblastoma, large-cell -1.600 1.4e-04
oligodendroglioma -1.100 2.9e-15
ovarian cancer -1.300 4.2e-05
primitive neuroectodermal tumor -1.100 2.2e-02
sonic hedgehog group medulloblastoma -1.500 1.4e-04
subependymal giant cell astrocytoma -1.320 1.6e-02

Gene RIF (1)

AA Sequence

MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFPHKKNDIPGPG      1 - 70
FYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFM     71 - 140
KALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSC    141 - 210
FKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGP    211 - 280
RKHFISSASFVSNTSRWTAAPPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL                    281 - 334
//

Text Mined References (7)

PMID Year Title