Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.46
PubTator Score 18.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 5.62791482804685E-10
atypical teratoid / rhabdoid tumor 4369 3.65314814389941E-9
pediatric high grade glioma 2712 8.12644533818881E-8
glioblastoma 5572 9.79298636481991E-7
medulloblastoma, large-cell 6234 1.58545415085996E-4
ependymoma 2514 0.00271729805750327
astrocytic glioma 2241 0.00346096805196157
primitive neuroectodermal tumor 3031 0.00365144164310602
oligodendroglioma 2849 0.0086475771048471
subependymal giant cell astrocytoma 2287 0.0304883624963961
Disease Target Count Z-score Confidence
Thyroid gland disease 4 0.0 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 0.003
ependymoma -1.400 0.003
oligodendroglioma -1.400 0.009
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.100 0.004
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.503 0.030

Synonym

Accession Q5TGZ0 Q96G68
Symbols MIO10
Mic10
C1orf151

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (3)

PMID Text
23704930 APOOL is a cardiolipin-binding component of the Mitofilin/MINOS protein complex.
22114354 Proteomic analyses reveal MINOS1/Mio10 as a novel constituent of Mitofilin/Fcj1 complexes in human and yeast mitochondria
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG      1 - 70
KYVKEQEQ                                                                   71 - 78
//

Text Mined References (19)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
24852370 2014 Genome-wide association study identifies a novel susceptibility gene for serum TSH levels in Chinese populations.
24687277 2014 Uniform nomenclature for the mitochondrial contact site and cristae organizing system.
23704930 2013 APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22114354 2012 MINOS1 is a conserved component of mitofilin complexes and required for mitochondrial function and cristae organization.
21944719 2011 Dual role of mitofilin in mitochondrial membrane organization and protein biogenesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...