Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.46
PubTator Score 18.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 4.8e-07
astrocytic glioma -1.100 3.5e-03
Astrocytoma, Pilocytic -1.200 6.6e-10
atypical teratoid / rhabdoid tumor -1.600 3.7e-09
ependymoma -1.400 2.7e-03
glioblastoma -1.500 4.4e-09
medulloblastoma, large-cell -1.400 1.6e-04
oligodendroglioma -1.400 8.6e-03
primitive neuroectodermal tumor -1.100 3.7e-03
subependymal giant cell astrocytoma -1.503 3.0e-02

Gene RIF (3)

AA Sequence

MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG      1 - 70
KYVKEQEQ                                                                   71 - 78
//

Text Mined References (19)

PMID Year Title