Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.14
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.78654032268771E-9
osteosarcoma 7933 7.2897294896547E-6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.176 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q5TGU0 B2RPR2 B7ZMN8 Q3SX82
Symbols BZRPL1

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19729679 identify the TSPO2 family of proteins as mediators of cholesterol redistribution-dependent erythroblast maturation during mammalian erythropoiesis
19625176 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYASYLVWKDLGG      1 - 70
GLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVSTALIWHPINKLAALLLLPYLA     71 - 140
WLTVTSALTYHLWRDSLCPVHQPQPTEKSD                                            141 - 170
//

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19729679 2009 Translocator protein 2 is involved in cholesterol redistribution during erythropoiesis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.