Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.78
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.8e-09
osteosarcoma 7950 7.3e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.176 7.3e-06
ovarian cancer 1.100 1.8e-09

Gene RIF (5)

AA Sequence

MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYASYLVWKDLGG      1 - 70
GLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVSTALIWHPINKLAALLLLPYLA     71 - 140
WLTVTSALTYHLWRDSLCPVHQPQPTEKSD                                            141 - 170
//

Text Mined References (7)

PMID Year Title