Property Summary

NCBI Gene PubMed Count 9
PubMed Score 42.33
PubTator Score 21.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hypospadias 53 4.563 2.3
Ebstein anomaly 16 3.157 1.6

Gene RIF (5)

AA Sequence

MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFR      1 - 70
SCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPL     71 - 140
LLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN                            141 - 186
//

Text Mined References (9)

PMID Year Title