Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
Funding $1,641,913.5
PubMed Score 41.77
PubTator Score 21.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Hypospadias 65 4.567 2.3

Gene RIF (5)

PMID Text
26783739 The STAT3-Ser/Hes3 Signaling Axis was first identified as a major regulator of neural stem cells and, subsequently, cancer stem cells
25371201 Data show that transcription factor Hes3 is expressed in adult pancreatic islets and dissociated cultures of pancreatic islet cells.
24512568 expression of the transcription factor Hes3 in the mouse and human ocular surface, and in pterygium
23393614 Hes3 is expressed in cultures from glioblastoma multiforme which express neural stem cell markers
18162467 CXorf6 transactivates the Hes3 promoter, augments testosterone production

AA Sequence

MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFR      1 - 70
SCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPL     71 - 140
LLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN                            141 - 186
//

Text Mined References (9)

PMID Year Title
26783739 2016 STAT3-Ser/Hes3 Signaling: A New Molecular Component of the Neuroendocrine System?
25371201 2014 Hes3 is expressed in the adult pancreatic islet and regulates gene expression, cell growth, and insulin release.
24512568 2014 Expression of the transcription factor Hes3 in the mouse and human ocular surface, and in pterygium.
23393614 2013 Hes3 regulates cell number in cultures from glioblastoma multiforme with stem cell characteristics.
18162467 2008 Mastermind-like domain-containing 1 (MAMLD1 or CXorf6) transactivates the Hes3 promoter, augments testosterone production, and contains the SF1 target sequence.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15254753 2004 Identification and characterization of human HES2, HES3, and HES5 genes in silico.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.