Property Summary

NCBI Gene PubMed Count 3
PubMed Score 7.59
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 9.32846309292157E-51
breast carcinoma 1614 7.83733392537327E-33
lung adenocarcinoma 2714 7.03430362940991E-9
interstitial cystitis 2299 0.00556245503833315
primary pancreatic ductal adenocarcinoma 1271 0.00915155758525692
osteosarcoma 7933 0.0127060587452703
atypical teratoid / rhabdoid tumor 4369 0.0165806929299679
pituitary cancer 1972 0.0369501118254197
invasive ductal carcinoma 2950 0.0431808554706439
primitive neuroectodermal tumor 3031 0.0478096358466833
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Disease Target Count Z-score Confidence
Chordoma 5 3.205 1.6
Secondary progressive multiple sclerosis 9 3.039 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.828 0.013
atypical teratoid / rhabdoid tumor 2.100 0.017
primitive neuroectodermal tumor 1.400 0.048
primary pancreatic ductal adenocarcinoma 1.199 0.009
breast carcinoma -2.100 0.000
interstitial cystitis -1.300 0.006
lung adenocarcinoma -1.100 0.000
Breast cancer -3.900 0.000
invasive ductal carcinoma -2.100 0.043
pituitary cancer -1.300 0.037

Synonym

Accession Q5TGI4 SAM domain-containing protein 5
Symbols dJ875H10.1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

 Compartment GO Term (2)

AA Sequence

MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAA      1 - 70
GLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVR     71 - 140
DGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR                                         141 - 173
//

Text Mined References (4)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.