Property Summary

NCBI Gene PubMed Count 3
PubMed Score 7.59
PubTator Score 0.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.828 0.013
atypical teratoid / rhabdoid tumor 2.100 0.017
primitive neuroectodermal tumor 1.400 0.048
primary pancreatic ductal adenocarcinoma 1.199 0.009
breast carcinoma -2.100 0.000
interstitial cystitis -1.300 0.006
lung adenocarcinoma -1.100 0.000
Breast cancer -3.900 0.000
invasive ductal carcinoma -2.100 0.043
pituitary cancer -1.300 0.037

Synonym

Accession Q5TGI4 SAM domain-containing protein 5
Symbols dJ875H10.1

Gene

 Compartment GO Term (1)

AA Sequence

MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAA      1 - 70
GLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVR     71 - 140
DGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR                                         141 - 173
//

Text Mined References (4)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.