Property Summary

NCBI Gene PubMed Count 3
PubMed Score 4.04
PubTator Score 0.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 2.0e-02
Breast cancer -3.900 9.3e-51
breast carcinoma -1.300 1.0e-04
interstitial cystitis -1.300 5.6e-03
invasive ductal carcinoma -2.100 4.3e-02
lung adenocarcinoma -1.100 7.0e-09
osteosarcoma 1.828 1.3e-02
pituitary cancer -1.300 3.7e-02
primary pancreatic ductal adenocarcinoma 1.199 9.2e-03
primitive neuroectodermal tumor 1.100 2.7e-02

Synonym

Accession Q5TGI4 SAM domain-containing protein 5
Symbols dJ875H10.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAA      1 - 70
GLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVR     71 - 140
DGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR                                         141 - 173
//

Text Mined References (4)

PMID Year Title