Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.05470033763781E-15
posterior fossa group A ependymoma 1511 1.54734852549601E-15
non-small cell lung cancer 2798 2.83998003931068E-12
atypical teratoid / rhabdoid tumor 4369 7.06664642467408E-10
glioblastoma 5572 4.41952824358439E-7
medulloblastoma, large-cell 6234 3.49615134735108E-6
pilocytic astrocytoma 3086 2.86959432365605E-5
adult high grade glioma 2148 6.72912734066906E-5
medulloblastoma 1524 9.23670006426687E-4
astrocytic glioma 2241 0.00200851011217542
Pick disease 1893 0.00829360933632954
head and neck cancer 270 0.0109045578372375
subependymal giant cell astrocytoma 2287 0.0110094375563196
ductal carcinoma in situ 1745 0.0239875503169254
oligodendroglioma 2849 0.0289497237584333

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.400 0.002
posterior fossa group A ependymoma -3.700 0.000
oligodendroglioma -1.800 0.029
glioblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.500 0.000
medulloblastoma -1.800 0.001
medulloblastoma, large-cell -2.300 0.000
non-small cell lung cancer 1.735 0.000
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -1.988 0.011
lung carcinoma 1.100 0.000
Pick disease -1.200 0.008
ductal carcinoma in situ 1.300 0.024
head and neck cancer -1.200 0.011

Synonym

Accession Q5TGI0 B3KU39 Q96F61 Q96LU3 Q9BR58 Q9BSS2
Symbols C6orf168
dJ273F20

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

AA Sequence

MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWKKTLYLT      1 - 70
GGALLAAAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGK     71 - 140
LSAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDN    141 - 210
LNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYI    211 - 280
MGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSE    281 - 350
GSKTHTPLLDFSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVDMDDYTDHEQCK               351 - 409
//

Text Mined References (6)

PMID Year Title
23942779 2013 A genome-wide association study of behavioral disinhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.