Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.400 0.002
posterior fossa group A ependymoma -3.700 0.000
oligodendroglioma -1.800 0.029
glioblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.500 0.000
medulloblastoma -1.800 0.001
medulloblastoma, large-cell -2.300 0.000
non-small cell lung cancer 1.735 0.000
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -1.988 0.011
lung carcinoma 1.100 0.000
Pick disease -1.200 0.008
ductal carcinoma in situ 1.300 0.024
head and neck cancer -1.200 0.011

AA Sequence

MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWKKTLYLT      1 - 70
GGALLAAAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGK     71 - 140
LSAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDN    141 - 210
LNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYI    211 - 280
MGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSE    281 - 350
GSKTHTPLLDFSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVDMDDYTDHEQCK               351 - 409
//

Text Mined References (6)

PMID Year Title
23942779 2013 A genome-wide association study of behavioral disinhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.