Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 2.0e-05
Breast cancer 3578 2.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 2.6e-02
cystic fibrosis -1.295 2.0e-05

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MSARPSLPPLPAKPAGSPRLRERPAPVGPGGEDAYSLLLRPQLGTRKVARAEEAGGEEGKREAEAWTRRA      1 - 70
AASARRGGELRTEEPPPPAARLCCLGGGCGGGGGGGQKVSATASIPFSCKRALLTSTIPLSPPAKRRGIR     71 - 140
TWGHPSYLTPSPTMRD                                                          141 - 156
//

Text Mined References (4)

PMID Year Title