Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q5TG53
Symbols C1orf133

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSARPSLPPLPAKPAGSPRLRERPAPVGPGGEDAYSLLLRPQLGTRKVARAEEAGGEEGKREAEAWTRRA      1 - 70
AASARRGGELRTEEPPPPAARLCCLGGGCGGGGGGGQKVSATASIPFSCKRALLTSTIPLSPPAKRRGIR     71 - 140
TWGHPSYLTPSPTMRD                                                          141 - 156
//

Text Mined References (4)

PMID Year Title
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.