Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.91
PubTator Score 9.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Composite lymphoma 3 3.664 1.8

Expression

Synonym

Accession Q5TFQ8 Q7Z3B9 SIRP-beta-1 isoform 3
Symbols CD172b
SIRP-BETA-1

Gene

PDB

2JJV  

Gene RIF (7)

PMID Text
25039969 SIRPB1 copy-number polymorphism was significantly associated with impulsive-disinhibited personality scores in a dose-dependent manner.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of signal-regulatory protein beta 1 (SIRPB1) in peptide-treated PBMCs
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
19893026 SIRPbeta1 is a novel IFN-induced microglial receptor that supports clearance of neural debris and Abeta aggregates by stimulating phagocytosis.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
16081415 SIRP beta 1 is a disulfide-linked homodimer in leukocytes that regulates neutrophil transepithelial migration

AA Sequence

MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAAGESATLHCTVTSLIPVGPIQWFRG      1 - 70
AGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAGTE     71 - 140
LSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS    141 - 210
TAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQ    211 - 280
RLQLTWLENGNVSRTETASTLTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSA    281 - 350
HPKEQGSNTAPGPALASAAPLLIAFLLGPKVLLVVGVSVIYVYWKQKA                          351 - 398
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25039969 2014 SIRPB1 copy-number polymorphism as candidate quantitative trait locus for impulsive-disinhibited personality.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
19893026 2009 Signal regulatory protein-beta1: a microglial modulator of phagocytosis in Alzheimer's disease.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18657508 2008 Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...