Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.29
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q5TFG8 B2RUZ7 Q5TFG9
Symbols C6orf94
FAM164B
dJ468K18.5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSK      1 - 70
SPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFC     71 - 140
KDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAK    141 - 210
LRQGFSKSSKKD                                                              211 - 222
//

Text Mined References (3)

PMID Year Title