Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.29
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q5TFG8 B2RUZ7 Q5TFG9
Symbols C6orf94
FAM164B
dJ468K18.5

Gene

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSK      1 - 70
SPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFC     71 - 140
KDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAK    141 - 210
LRQGFSKSSKKD                                                              211 - 222
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.