Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.43
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 0.006
ependymoma -1.500 0.015
oligodendroglioma -1.500 0.013
osteosarcoma -1.924 0.000
glioblastoma -1.400 0.003
cystic fibrosis 2.105 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.004
pediatric high grade glioma -1.500 0.000
group 4 medulloblastoma -1.500 0.003
progressive supranuclear palsy -1.100 0.045
invasive ductal carcinoma -1.100 0.004
ovarian cancer -2.200 0.000

Gene RIF (4)

PMID Text
22736055 The rs1052443 C allele of NT5DC1 was associated with a protective effect against the deterioration of pulmonary function.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKELLNVTPEDWDFCCKGLALDL      1 - 70
EDGNFLKLANNGTVLRASHGTKMMTPEVLAEAYGKKEWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCA     71 - 140
RVVDYLTKLNNGQKTFDFWKDIVAAIQHNYKMSAFKENCGIYFPEIKRDPGRYLHSCPESVKKWLRQLKN    141 - 210
AGKILLLITSSHSDYCRLLCEYILGNDFTDLFDIVITNALKPGFFSHLPSQRPFRTLENDEEQEALPSLD    211 - 280
KPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEE    281 - 350
SEPLEKKGKYEGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCKRISTYSTIAIPSIEAIAELP    351 - 420
LDYKFTRFSSSNSKTAGYYPNPPLVLSSDETLISK                                       421 - 455
//

Text Mined References (14)

PMID Year Title
23455636 2013 Seven new loci associated with age-related macular degeneration.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22736055 2012 Single-nucleotide polymorphisms in the TSPYL-4 and NT5DC1 genes are associated with susceptibility to chronic obstructive pulmonary disease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...