Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Eosinophilic esophagitis 31
Disease Target Count P-value
Breast cancer 3099 5.77307164519246E-26
breast carcinoma 1614 6.83658957633276E-22
posterior fossa group B ependymoma 1530 1.54167634791808E-6
nasopharyngeal carcinoma 1056 2.80635499864726E-5
sonic hedgehog group medulloblastoma 1482 1.58848667218637E-4
atypical teratoid/rhabdoid tumor 1095 3.56284320969515E-4
medulloblastoma, large-cell 6234 0.00252491806239759
subependymal giant cell astrocytoma 2287 0.0446394694173907

Expression

Synonym

Accession Q5TF58 Q9H7K0
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

AA Sequence

MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAK      1 - 70
VHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVAL     71 - 140
GGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLA    141 - 210
KVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLD    211 - 280
TKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDD    281 - 350
EVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHET    351 - 420
ESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSS    421 - 490
VASSDSGSTDEIQDEFEREADVEPMVS                                               491 - 517
//

Text Mined References (4)

PMID Year Title
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.