Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 3.6e-04
Breast cancer -2.200 5.8e-26
breast carcinoma -1.100 6.8e-22
medulloblastoma, large-cell -1.400 2.5e-03
nasopharyngeal carcinoma -1.100 2.8e-05
posterior fossa group B ependymoma -1.300 1.5e-06
sonic hedgehog group medulloblastoma -1.500 1.6e-04
subependymal giant cell astrocytoma -1.084 4.5e-02

Synonym

Accession Q5TF58 Q9H7K0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGLNVRFRCFLAK      1 - 70
VHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPGGGHGLSSGAAAGANANAVAL     71 - 140
GGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQGPGVSWVHPDGVGVQIDTITPEIRALYNVLA    141 - 210
KVKRERDEYKRRWEEELAKRMNLQTMVDTLQEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLD    211 - 280
TKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDD    281 - 350
EVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHET    351 - 420
ESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSS    421 - 490
VASSDSGSTDEIQDEFEREADVEPMVS                                               491 - 517
//

Text Mined References (4)

PMID Year Title