Property Summary

NCBI Gene PubMed Count 5
PubMed Score 14.23
PubTator Score 0.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.100 3.8e-03
ependymoma 1.200 1.9e-02
intraductal papillary-mucinous carcinoma... 1.100 1.7e-02
ovarian cancer -1.100 4.6e-03
Pick disease 1.300 4.1e-06
progressive supranuclear palsy 1.300 5.3e-03

AA Sequence

MLCASFLGLGLSVAIVGPTFQDLATNVNRNISSLSFIFVGRALGYLSGSVIGGFLVDVMNYFLLLGISMS      1 - 70
ATTVGLYLVPFCKTAILLTVMMSIFGVSIGILDTGGNVLILAIWGDKGAPHMQALHFSFALGAFLAPLLA     71 - 140
KLALGPTASAENHTESDFHPALNQSSDADSEALFGVPNDKNLLWAYAVIGTYMFLVSVIFFCLFLKNSSK    141 - 210
QEKARASAETFRRAKYHNALLCLLFLFFFFYVGAEVTYGSYVFSFATTHAGMKESEAAGLNSIFWGTFAA    211 - 280
CRGLAIFFATCLQPGTMIVLSNIGSLTSSLFLVLFDKNPICLWIATSVYGASMATTFPSGVSWIEQYTTI    281 - 350
HGKSAAFFVIGASLGEMAIPAVIGILQGKYPDLPVVLYTSLGASIATGILFPVLYKLATSPLDRQRKEDR    351 - 420
KSEDQKALLSSSGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNA    421 - 490
LVFESSPFNTGSAHVKHLPETRTKGTNV                                              491 - 518
//

Text Mined References (7)

PMID Year Title