Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11
PubTator Score 0.13

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6



Accession Q5TF21
Symbols C6orf174


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

QMFQPIILLILILVLFSSLSYTTIFKLVFLFTLFFVL                                     911 - 947

Text Mined References (3)

PMID Year Title