Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q5TEZ4 A6NM89
Symbols C6orf164
dJ102H19.4

 Compartment GO Term (0)

AA Sequence

MSHLPAVSPVFFQLPAPHPPTVLRPQLGLHPNPECDREKMSVRDHDPEVLTRNSACKPRGQLSGHLLKPR      1 - 70
APLEAA                                                                     71 - 76
//

Text Mined References (3)

PMID Year Title