Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MLCCCPLADALLIFLETGSCFQPGQQSETLSQKQNKTNNKKWAGGAGCRPFRLWWVGRSRGAGVQLYSTK      1 - 70
KGWILRGKGGTEA                                                              71 - 83
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.