Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.51
PubTator Score 19.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.135 2.8e-02
cutaneous lupus erythematosus 1.900 1.4e-03
gastric carcinoma 1.400 1.6e-02
glioblastoma 1.600 1.1e-02
group 3 medulloblastoma -1.100 4.0e-02
interstitial cystitis 2.200 6.5e-04
invasive ductal carcinoma 1.707 1.9e-04
lung adenocarcinoma -1.235 5.4e-06
lung cancer -1.600 1.3e-04
lung carcinoma -2.100 2.4e-24
malignant mesothelioma -1.800 4.7e-06
mucosa-associated lymphoid tissue lympho... 1.163 3.8e-02
non-small cell lung cancer -1.451 7.2e-16
osteosarcoma -2.894 1.9e-04
periodontitis 1.300 2.9e-30
ulcerative colitis 2.000 8.2e-05

Gene RIF (12)

AA Sequence

MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQT      1 - 70
MELAPNFQGYFTPLNTPQSYETLEELVSATTQSSKQLPTCFMSTHRIVTEGRVVTEDQLLMLEAVVMHLG     71 - 140
IRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEI    141 - 210
QAIMHMRRTIVKIPSTLEVDVEDVTASSRHVHFIKPLLLSEVLAWEGPFPLSMEILEVPEGRPIFLSPWV    211 - 280
GSLQKGQRLCVYGLASPPWRVLASSKGRKVPRHFLVSGGYQGKLRRRPREFPTAYDLLGAFQPGRPLRVV    281 - 350
ATKDCEGEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERV    351 - 420
LLPFHFPGSFVEEMSDSRRYSLADLTAQFSLPCEVKVVAKDTSHPTDPLTSFLGLRLEEKITEPFLVVSL    421 - 490
DSEPGMCFEIPPRWLDLTVVKAKGQPDLPEGSLPIATVEELTDTFYYRLRKLPACEIQAPPPRPPKNQGL    491 - 560
SKQRRHSSEGGVKSSQVLGLQQHARLPKPKAKTLPEFIKDGSSTYSKIPAHRKGHRPAKPQRQDLDDDEH    561 - 630
DYEEILEQFQKTI                                                             631 - 643
//

Text Mined References (20)

PMID Year Title