Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.51
PubTator Score 19.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
cutaneous lupus erythematosus 2.000 0.001
osteosarcoma -2.894 0.000
glioblastoma 2.000 0.010
periodontitis 1.500 0.000
adrenocortical carcinoma -1.135 0.028
non-small cell lung cancer -1.553 0.000
lung cancer -2.500 0.000
interstitial cystitis 2.300 0.000
group 4 medulloblastoma -1.200 0.004
invasive ductal carcinoma 1.788 0.000
lung adenocarcinoma -1.235 0.000
lung carcinoma -2.100 0.000
gastric carcinoma 1.800 0.008
mucosa-associated lymphoid tissue lympho... 1.163 0.038
ulcerative colitis 2.300 0.000

Gene RIF (12)

PMID Text
24826199 SNP rs1467465 of the human gene icb-1 might affect susceptibility to ovarian cancer.
23474491 Loss of icb-1 expression accelerated proliferation of SK-OV-3, OVCAR-3 and OAW-42 cells and led to upregulation of ovarian cancer biomarkers like KLK10 and CLDN16.
22732588 Themis2 and Themis1 exhibit the same potential to restore T cell development and T cell receptor-mediated signaling in Themis1-deficient mice.
22565810 Data of this study suggest that icb-1 might exert a tumor-suppressor function in breast cancer and that its loss might confer relative resistance of breast cancer cells to apoptotic drugs.
21455565 These findings together with the observed co-expression of icb-1 with E-cadherin in breast cancer samples support an important role of the icb-1 gene in cancer cell differentiation.
20569072 Data show that a highly significant positive correlation of icb-1 transcript levels with c-erbB2 (HER2) expression (p <.0001).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19942713 Identification of ICB-1 as a new player in endocrine-related cancer.
19308812 Data suggest that SNP rs1467465 of human gene icb-1 might affect breast cancer susceptibility.
19308812 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQT      1 - 70
MELAPNFQGYFTPLNTPQSYETLEELVSATTQSSKQLPTCFMSTHRIVTEGRVVTEDQLLMLEAVVMHLG     71 - 140
IRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEI    141 - 210
QAIMHMRRTIVKIPSTLEVDVEDVTASSRHVHFIKPLLLSEVLAWEGPFPLSMEILEVPEGRPIFLSPWV    211 - 280
GSLQKGQRLCVYGLASPPWRVLASSKGRKVPRHFLVSGGYQGKLRRRPREFPTAYDLLGAFQPGRPLRVV    281 - 350
ATKDCEGEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERV    351 - 420
LLPFHFPGSFVEEMSDSRRYSLADLTAQFSLPCEVKVVAKDTSHPTDPLTSFLGLRLEEKITEPFLVVSL    421 - 490
DSEPGMCFEIPPRWLDLTVVKAKGQPDLPEGSLPIATVEELTDTFYYRLRKLPACEIQAPPPRPPKNQGL    491 - 560
SKQRRHSSEGGVKSSQVLGLQQHARLPKPKAKTLPEFIKDGSSTYSKIPAHRKGHRPAKPQRQDLDDDEH    561 - 630
DYEEILEQFQKTI                                                             631 - 643
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24826199 2014 Icb-1 gene polymorphism rs1467465 is associated with susceptibility to ovarian cancer.
23474491 2013 icb-1 Gene counteracts growth of ovarian cancer cell lines.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22732588 2012 Interchangeability of Themis1 and Themis2 in thymocyte development reveals two related proteins with conserved molecular function.
22565810 2012 Network analysis of icb-1 gene function in human breast cancer cells.
21455565 2011 Silencing of the icb-1 gene inhibits the induction of differentiation-associated genes by vitamin D3 and all-trans retinoic acid in gynecological cancer cells.
20644716 2010 Themis2/ICB1 is a signaling scaffold that selectively regulates macrophage Toll-like receptor signaling and cytokine production.
20569072 2010 Icb-1 Gene expression is elevated in human endometrial adenocarcinoma and is closely associated with HER2 expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...