Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.059 4.9e-02
active ulcerative colitis 1.143 3.5e-02
astrocytic glioma -1.400 4.8e-03
cystic fibrosis 2.139 5.5e-06
ependymoma -1.800 7.7e-03
oligodendroglioma -1.700 3.1e-03
ovarian cancer -1.700 7.0e-09
pituitary cancer -2.600 1.2e-06
sarcoidosis 1.100 2.5e-02
tuberculosis -2.100 1.5e-05

AA Sequence

MKQEDNQGVCAHQDSEDKGMGSDFEDSEDREGDPEEREMGSNPHDTNKREGHPEPEMGSNPQDSRHREAV      1 - 70
PDICTEGQLSEEEGVSVRGEEDDQSGVADMAMFPGLSESDSISRSLREDDDESAGENRLEEEEEQPAPPV     71 - 140
LPWRRHLSLGSRHRGDKPAHRRFHRLHHPMAVDLGELDSLVASIMDAPTICPDCGESFSPGAAFLQHQRI    141 - 210
HRLAEAAAAASLEPFGLAGECDAMVGMMGVGVAGGFGAGPPLARPPREKPFRCGECGKGFSRNTYLTNHL    211 - 280
RLHTGERPNLCADCGKSFSWRADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAAASGAGAAAL    281 - 350
RPFACGECGKGFVRRSHLANHQRIHTGEKPHGCGECGKRFSWRSDLVKHQRVHTGEKPYMCSECGETFSV    351 - 420
SSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEKRFSDFSTLTQHQRTHTGE    421 - 490
KPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRYKTHLAQHQKLHLC                   491 - 545
//

Text Mined References (5)

PMID Year Title