Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 6.97409330221677E-9
ulcerative colitis 2087 1.15417386417583E-6
pituitary cancer 1972 1.17670458284197E-6
cystic fibrosis 1670 5.51162186753546E-6
tuberculosis 1563 1.54820665273517E-5
oligodendroglioma 2849 0.00310658481666723
astrocytic glioma 2241 0.00478743286891372
ependymoma 2514 0.00769895085693719
sarcoidosis 368 0.0245049902270865
active Crohn's disease 918 0.0488173974561626

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 0.005
ependymoma -1.800 0.008
oligodendroglioma -1.700 0.003
cystic fibrosis 2.139 0.000
tuberculosis -2.100 0.000
active Crohn's disease 1.059 0.049
ulcerative colitis 1.300 0.000
sarcoidosis 1.100 0.025
ovarian cancer -1.700 0.000
pituitary cancer -2.600 0.000

Synonym

Accession Q5TEC3 Q96IT2
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

AA Sequence

MKQEDNQGVCAHQDSEDKGMGSDFEDSEDREGDPEEREMGSNPHDTNKREGHPEPEMGSNPQDSRHREAV      1 - 70
PDICTEGQLSEEEGVSVRGEEDDQSGVADMAMFPGLSESDSISRSLREDDDESAGENRLEEEEEQPAPPV     71 - 140
LPWRRHLSLGSRHRGDKPAHRRFHRLHHPMAVDLGELDSLVASIMDAPTICPDCGESFSPGAAFLQHQRI    141 - 210
HRLAEAAAAASLEPFGLAGECDAMVGMMGVGVAGGFGAGPPLARPPREKPFRCGECGKGFSRNTYLTNHL    211 - 280
RLHTGERPNLCADCGKSFSWRADLLKHRRLHTGEKPYPCPECGEAFSLSSHLLSHRRAHAAASGAGAAAL    281 - 350
RPFACGECGKGFVRRSHLANHQRIHTGEKPHGCGECGKRFSWRSDLVKHQRVHTGEKPYMCSECGETFSV    351 - 420
SSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEKRFSDFSTLTQHQRTHTGE    421 - 490
KPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRYKTHLAQHQKLHLC                   491 - 545
//

Text Mined References (3)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.