Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.89
PubTator Score 7.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.600 2.6e-06
lung cancer 1.100 6.2e-03
non-small cell lung cancer 1.120 8.2e-04

Synonym

Accession Q5TDP6 A1L421 Q0PVN9 Q0PVP0 Q9NYJ0
Symbols LGS
GLULD1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (6)

AA Sequence

MNNEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMRDSSQILTPPQLS      1 - 70
SRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRA     71 - 140
TCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDF    141 - 210
CIFGVPEILNSKIISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSAD    211 - 280
NAFTLRTGVKEVARKYNYIASFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLK    281 - 350
HSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL    351 - 420
AATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFVAMKKY    421 - 490
ELENEEIAAERNKFLEYFI                                                       491 - 509
//

Text Mined References (13)

PMID Year Title