Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.26
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.053 8.9e-04
adult high grade glioma -1.100 2.7e-04
interstitial cystitis -1.100 1.4e-04
juvenile dermatomyositis 1.031 3.5e-07
osteosarcoma 1.228 3.0e-04
ovarian cancer -1.300 4.7e-04
spina bifida -1.075 4.9e-02
tuberculosis -1.200 5.7e-07

Gene RIF (2)

AA Sequence

MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGD      1 - 70
VVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRD     71 - 140
MLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDI    141 - 210
RQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAG    211 - 280
IAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQT    281 - 350
TFLPEGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP                         351 - 399
//

Text Mined References (19)

PMID Year Title