Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.17
PubTator Score 1.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.47606388321434E-7
tuberculosis 1563 5.66636480639586E-7
osteosarcoma 7933 9.20230835123375E-6
interstitial cystitis 2299 1.39827584538888E-4
adult high grade glioma 2148 2.68431866458017E-4
ovarian cancer 8492 4.71774312146857E-4
acute quadriplegic myopathy 1157 8.91064253103269E-4
spina bifida 1064 0.0491837018989847

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.855 0.000
juvenile dermatomyositis 1.031 0.000
acute quadriplegic myopathy 1.053 0.001
tuberculosis -1.200 0.000
interstitial cystitis -1.100 0.000
adult high grade glioma -1.100 0.000
spina bifida -1.075 0.049
ovarian cancer -1.300 0.000

Synonym

Accession Q5TDH0 A8KAE1 Q7RTZ0 Q9BRT1
Symbols

Gene

PDB

2N7D   4RGH   5K57  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGD      1 - 70
VVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRD     71 - 140
MLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDI    141 - 210
RQQNIEENMTIAMEEAPESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAG    211 - 280
IAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGSQT    281 - 350
TFLPEGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP                         351 - 399
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...