Property Summary

NCBI Gene PubMed Count 39
PubMed Score 3.43
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (11)

AA Sequence

MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCT      1 - 70
KCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTK     71 - 140
PLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFC    141 - 210
VDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGM    211 - 280
DTDI                                                                      281 - 284
//

Text Mined References (39)

PMID Year Title