Property Summary

NCBI Gene PubMed Count 37
Grant Count 1
Funding $140,000
PubMed Score 3.43
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of four and a half LIM domains 5 (FHL5) in primary human brain microvascular endothelial cells
23127979 Identified CREB activators MAPKAPK3 and FHL5 as mediators of intimal hyperplasia in vein graft samples.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20488182 Results indicate that SPAG8 acts as a regulator of ACT and plays an important role in CREM-ACT-mediated gene transcription during spermatogenesis.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20378615 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17368652 Observational study of gene-disease association. (HuGE Navigator)
16687568 Observational study of gene-disease association. (HuGE Navigator)
16687568 Different haplotypes within the ACT gene may contribute to male factor subfertility.
More...

AA Sequence

MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCT      1 - 70
KCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTK     71 - 140
PLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFC    141 - 210
VDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGM    211 - 280
DTDI                                                                      281 - 284
//

Text Mined References (37)

PMID Year Title
26660531 2016 Gene-based pleiotropy across migraine with aura and migraine without aura patient groups.
26231841 2015 Association of genetic loci for migraine susceptibility in the she people of China.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23127979 2013 Cyclic adenosine monophosphate response-element binding protein activation by mitogen-activated protein kinase-activated protein kinase 3 and four-and-a-half LIM domains 5 plays a key role for vein graft intimal hyperplasia.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22319020 2012 A genome-wide association study for coronary artery disease identifies a novel susceptibility locus in the major histocompatibility complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21459774 2011 An autosomal locus that controls chromosome-wide replication timing and mono-allelic expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...