Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.47
PubTator Score 5.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.4e-03
ependymoma 3.100 8.6e-11
lung adenocarcinoma -1.600 1.8e-08
lung carcinoma -1.200 4.0e-03
nasopharyngeal carcinoma -2.600 1.2e-07
non-small cell lung carcinoma -1.300 3.3e-09
osteosarcoma -1.366 1.2e-03

Gene RIF (3)

AA Sequence

MEDSTSPKQEKENQEELGETRRPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTP      1 - 70
LGGPAGPETSSPAPVSPREPSSSPSPLAPARQDLAAPPQSDRTTSVIPEAGTPYPDPLEQSSDKRESTPH     71 - 140
HTSQSEGNTFQQSQQPKPHLCGRRDVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEIT    141 - 210
IQNAKAYLLKTSSNSGFNLYDHLSNMLTKILNERPENAVDIFENISQDVKMAHFSKKFDALQNENELLPT    211 - 280
YEIAEKQKALFLQGHLEGVDQELEDEIAENALPNVMESAFYFEQAGVGLGTDETYRIFLALKQLTDTHPI    281 - 350
QRCRFWGKILGLEMNYIVAEVEFREGEDEEEVEEEDVAEERDNGESEAHEDEEDELPKSFYKAPQAIPKE    351 - 420
ESRTGANKYVYFVCNEPGRPWVKLPPVIPAQIVIARKIKKFFTGRLDAPIISYPPFPGNESNYLRAQIAR    421 - 490
ISAGTHVSPLGFYQFGEEEGEEEEEAEGGRNSFEENPDFEGIQVIDLVESLSNWVHHVQHILSQGRCNWF    491 - 560
NSIQKNEEEEEEEDEEKDDSDYIEQEVGLPLLTPISEDLEIQNIPPWTTRLSSNLIPQYAIAVLQSNLWP    561 - 630
GAYAFSNGKKFENFYIGWGHKYSPDNYTPPVPPPVYQEYPSGPEITEMDDPSVEEEQAFRAAQEAVLLAA    631 - 700
ENEESEEDEDEEDDYD                                                          701 - 716
//

Text Mined References (13)

PMID Year Title