Property Summary

NCBI Gene PubMed Count 33
PubMed Score 30.69
PubTator Score 26.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.123 6.9e-03
adult high grade glioma -1.100 6.1e-03
astrocytic glioma -1.300 2.4e-02
Astrocytoma, Pilocytic -1.200 4.9e-05
atypical teratoid / rhabdoid tumor -2.000 1.8e-04
cutaneous lupus erythematosus -1.800 7.7e-03
malignant mesothelioma -1.400 7.6e-06
medulloblastoma, large-cell -1.600 5.6e-04
osteosarcoma 1.461 1.3e-02
ovarian cancer 1.600 3.5e-05
pancreatic cancer 3.100 3.6e-04
pancreatic ductal adenocarcinoma liver m... 1.102 4.5e-02
pituitary cancer -1.700 7.5e-07
primitive neuroectodermal tumor -1.100 1.5e-04
psoriasis -1.300 1.3e-04
tuberculosis and treatment for 3 months -1.100 1.4e-05

Gene RIF (24)

AA Sequence

MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQR      1 - 70
IIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARPEDVNPPKEDYGSSKR     71 - 140
KSVWLSSWAESPKKDVTGADATAEPMILEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSE    141 - 210
EQGWVPATYLEAQNGTRDDSDINTSKTGEVSKRRKAHLRRLDRRWTLGGMVNRQHSREEKYVTVQPYTSQ    211 - 280
SKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDDLPTRKKNLAGPVEIIGNIMEISNL    281 - 350
LNKKASGDKETPPAEGEGHEAPIAKKEISLPILCNASNGSAVGVPDRTVSRLAQGSPAVARIAPQRAQIS    351 - 420
SPNLRTRPPPRRESSLGFQLPKPPEPPSVEVEYYTIAEFQSCISDGISFRGGQKAEVIDKNSGGWWYVQI    421 - 490
GEKEGWAPASYIDKRKKPNLSRRTSTLTRPKVPPPAPPSKPKEAEEGPTGASESQDSPRKLKYEEPEYDI    491 - 560
PAFGFDSEPELSEEPVEDRASGERRPAQPHRPSPASSLQRARFKVGESSEDVALEEETIYENEGFRPYAE    561 - 630
DTLSARGSSGDSDSPGSSSLSLTRKNSPKSGSPKSSSLLKLKAEKNAQAEMGKNHSSASFSSSITINTTC    631 - 700
CSSSSSSSSSLSKTSGDLKPRSASDAGIRGTPKVRAKKDADANAGLTSCPRAKPSVRPKPFLNRAESQSQ    701 - 770
EKMDISTLRRQLRPTGQLRGGLKGSKSEDSELPPQTASEAPSEGSRRSSSDLITLPATTPPCPTKKEWEG    771 - 840
PATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKELD    841 - 910
TVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQ    911 - 980
SVFVSPPPKDNNLSCALRRNESLTATDGLRGVRRNSSFSTARSAAAEAKGRLAERAASQGSDSPLLPAQR    981 - 1050
NSIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPF   1051 - 1120
KGWVPSNYLEKKN                                                            1121 - 1133
//

Text Mined References (38)

PMID Year Title