Property Summary

NCBI Gene PubMed Count 29
Grant Count 16
R01 Count 15
Funding $1,637,055.73
PubMed Score 28.21
PubTator Score 26.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (20)

PMID Text
26446840 Results suggest that Tks5, similar to XB130, plays a role in cell proliferation and cell survival and that the interaction between XB130 and Tks5 appears to be critical for regulation of Src-mediated cellular homeostasis.
26334100 TKS5 and MYLK represent two mediators of invasive behavior of cancer cells that are regulated by the ZEB1/miR-200 feedback loop
25826475 establishes an important role for Tks5 in tumor growth in vivo, and suggests that invadopodia may play broad roles in tumor progression
25564649 Inhibiting the function of Tks5 both reduced extracellular matrix degradation in vitro and disrupted motoneuron axons from exiting the spinal cord and extending into the periphery.
24993883 Results show that TKS5 is highly expressed in many cancer types with strong correlation with increased metastatic events and a poorer prognosis suggesting a clinical importance.
24206842 Tks5 is needed for breast carcinoma cell invadopodium precursor stabilization, where the phox homology (PX) domain of Tks5 interacts with PI(3,4)P2. SHIP2 arrival at the invadopodium precursor coincides with the onset of PI(3,4)P2 accumulation.
24174371 Src-dependent Tks5 phosphorylation regulates invadopodia-associated invasion in prostate cancer cells.
23873940 high Tks5long and low Tks5short expressions in human lung adenocarcinomas correlated with metastatic disease and predicted worse survival of early stage patients
23544093 Genes including LEP and SH3PXD2A were differentially expressed (p<0.05 and fold change >1.5) in pre-eclampsia placentas.
22584907 Tks5, a master regulator of invadopodia in cancer cells, is crucial for osteoclast fusion downstream of phosphoinositide 3-kinase and Src.
More...

AA Sequence

MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQR      1 - 70
IIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARPEDVNPPKEDYGSSKR     71 - 140
KSVWLSSWAESPKKDVTGADATAEPMILEQYVVVSNYKKQENSELSLQAGEVVDVIEKNESGWWFVSTSE    141 - 210
EQGWVPATYLEAQNGTRDDSDINTSKTGEVSKRRKAHLRRLDRRWTLGGMVNRQHSREEKYVTVQPYTSQ    211 - 280
SKDEIGFEKGVTVEVIRKNLEGWWYIRYLGKEGWAPASYLKKAKDDLPTRKKNLAGPVEIIGNIMEISNL    281 - 350
LNKKASGDKETPPAEGEGHEAPIAKKEISLPILCNASNGSAVGVPDRTVSRLAQGSPAVARIAPQRAQIS    351 - 420
SPNLRTRPPPRRESSLGFQLPKPPEPPSVEVEYYTIAEFQSCISDGISFRGGQKAEVIDKNSGGWWYVQI    421 - 490
GEKEGWAPASYIDKRKKPNLSRRTSTLTRPKVPPPAPPSKPKEAEEGPTGASESQDSPRKLKYEEPEYDI    491 - 560
PAFGFDSEPELSEEPVEDRASGERRPAQPHRPSPASSLQRARFKVGESSEDVALEEETIYENEGFRPYAE    561 - 630
DTLSARGSSGDSDSPGSSSLSLTRKNSPKSGSPKSSSLLKLKAEKNAQAEMGKNHSSASFSSSITINTTC    631 - 700
CSSSSSSSSSLSKTSGDLKPRSASDAGIRGTPKVRAKKDADANAGLTSCPRAKPSVRPKPFLNRAESQSQ    701 - 770
EKMDISTLRRQLRPTGQLRGGLKGSKSEDSELPPQTASEAPSEGSRRSSSDLITLPATTPPCPTKKEWEG    771 - 840
PATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENEQPDPSGKELD    841 - 910
TVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQ    911 - 980
SVFVSPPPKDNNLSCALRRNESLTATDGLRGVRRNSSFSTARSAAAEAKGRLAERAASQGSDSPLLPAQR    981 - 1050
NSIPVSPVRPKPIEKSQFIHNNLKDVYVSIADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPF   1051 - 1120
KGWVPSNYLEKKN                                                            1121 - 1133
//

Text Mined References (34)

PMID Year Title
26446840 2015 XB130/Tks5 scaffold protein interaction regulates Src-mediated cell proliferation and survival.
26334100 2015 The ZEB1/miR-200c feedback loop regulates invasion via actin interacting proteins MYLK and TKS5.
25826475 2015 The invadopodia scaffold protein Tks5 is required for the growth of human breast cancer cells in vitro and in vivo.
25564649 2015 Regulation of ECM degradation and axon guidance by growth cone invadosomes.
24993883 2014 Expression of the adaptor protein Tks5 in human cancer: prognostic potential.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24206842 2013 Tks5 and SHIP2 regulate invadopodium maturation, but not initiation, in breast carcinoma cells.
24174371 2014 Src-dependent Tks5 phosphorylation regulates invadopodia-associated invasion in prostate cancer cells.
23873940 2013 Differential Tks5 isoform expression contributes to metastatic invasion of lung adenocarcinoma.
23544093 2013 Up-regulated expression and aberrant DNA methylation of LEP and SH3PXD2A in pre-eclampsia.
More...