Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $110,291
PubMed Score 11.38
PubTator Score 11.26

Knowledge Summary

Patent (2,177)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -2.300 0.000
posterior fossa group B ependymoma -1.400 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q5TCY1 A2A2U5 Q2L6C6 Q6ZNH0 Q8N444 Q96JH2
Symbols BDTK

Gene

PDB

4BTJ   4BTK   4BTM   4NFM   4NFN  

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model

 Collection (1)

Gene RIF (7)

PMID Text
25473830 TTBK1/2 kinases may represent attractive targets for therapeutic intervention for TDP-43 proteinopathies such as Amyotrophic lateral sclerosis and Frontotemporal lobar degeneration-TDP.
24637750 X-ray diffraction data were collected and the structure of TTBK1 was determined by molecular replacement both as an apo structure and in complex with a kinase inhibitor
23088643 The study suggested that a role for TTBK1 in pre-tangle formation prior to the formation of fibrillar tau and strengthen the idea that tau is phosphorylated at Ser422 at an early/intermediate stage in NFT formation.
21219968 TTBK1 may play an important role in the pathogenesis of sporadic late-onset Alzheimer's disease in a Han Chinese population.
20096481 This study demonistrated that TTBK1 is a promising new candidate tau phosphorylation-related gene for Alzheimer's disease risk.
20096481 Observational study of gene-disease association. (HuGE Navigator)
19118186 TTBK1 in AD brain may be one of the underlying mechanisms inducing CDK5 and calpain activation, NR2B downregulation, and subsequent memory dysfunction.

AA Sequence

MQCLAAALKDETNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQP      1 - 70
KQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILE     71 - 140
SIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNA    141 - 210
HKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDY    211 - 280
FTKPDYQLIMSVFENSMKERGIAENEAFDWEKAGTDALLSTSTSTPPQQNTRQTAAMFGVVNVTPVPGDL    281 - 350
LRENTEDVLQGEHLSDQENAPPILPGRPSEGLGPSPHLVPHPGGPEAEVWEETDVNRNKLRINIGKSPCV    351 - 420
EEEQSRGMGVPSSPVRAPPDSPTTPVRSLRYRRVNSPESERLSTADGRVELPERRSRMDLPGSPSRQACS    421 - 490
SQPAQMLSVDTGHADRQASGRMDVSASVEQEALSNAFRSVPLAEEEDFDSKEWVIIDKETELKDFPPGAE    491 - 560
PSTSGTTDEEPEELRPLPEEGEERRRLGAEPTVRPRGRSMQALAEEDLQHLPPQPLPPQLSQGDGRSETS    561 - 630
QPPTPGSPSHSPLHSGPRPRRRESDPTGPQRQVFSVAPPFEVNGLPRAVPLSLPYQDFKRDLSDYRERAR    631 - 700
LLNRVRRVGFSHMLLTTPQVPLAPVQPQANGKEEEEEEEEDEEEEEEDEEEEEEEEEEEEEEEEEEEEEE    701 - 770
EAAAAVALGEVLGPRSGSSSEGSERSTDRSQEGAPSTLLADDQKESRGRASMADGDLEPEEGSKTLVLVS    771 - 840
PGDMKKSPVTAELAPDPDLGTLAALTPQHERPQPTGSQLDVSEPGTLSSVLKSEPKPPGPGAGLGAGTVT    841 - 910
TGVGGVAVTSSPFTKVERTFVHIAEKTHLNVMSSGGQALRSEEFSAGGELGLELASDGGAVEEGARAPLE    911 - 980
NGLALSGLNGAEIEGSALSGAPRETPSEMATNSLPNGPALADGPAPVSPLEPSPEKVATISPRRHAMPGS    981 - 1050
RPRSRIPVLLSEEDTGSEPSGSLSAKERWSKRARPQQDLARLVMEKRQGRLLLRLASGASSSSSEEQRRA   1051 - 1120
SETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQPASRSHGAAPALDTAITS   1121 - 1190
RLQLQTPPGSATAADLRPKQPPGRGLGPGRAQAGARPPAPRSPRLPASTSAARNASASPRSQSLSRRESP   1191 - 1260
SPSHQARPGVPPPRGVPPARAQPDGTPSPGGSKKGPRGKLQAQRATTKGRAGGAEGRAGAR            1261 - 1321
//

Text Mined References (20)

PMID Year Title
26508570 2016 De novo variants in sporadic cases of childhood onset schizophrenia.
26323690 2015 TTBK2 with EB1/3 regulates microtubule dynamics in migrating cells through KIF2A phosphorylation.
25673844 2015 Phosphorylation of synaptic vesicle protein 2A at Thr84 by casein kinase 1 family kinases controls the specific retrieval of synaptotagmin-1.
25473830 2014 The tau tubulin kinases TTBK1/2 promote accumulation of pathological TDP-43.
24637750 2014 The structure of human tau-tubulin kinase 1 both in the apo form and in complex with an inhibitor.
23088643 2013 Tau-tubulin kinase 1 expression, phosphorylation and co-localization with phospho-Ser422 tau in the Alzheimer's disease brain.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21219968 2011 Tau-tubulin kinase-1 gene variants are associated with Alzheimer's disease in Han Chinese.
20096481 2011 Genetic variations in tau-tubulin kinase-1 are linked to Alzheimer's disease in a Spanish case-control cohort.
19118186 2008 Spatial learning impairment, enhanced CDK5/p35 activity, and downregulation of NMDA receptor expression in transgenic mice expressing tau-tubulin kinase 1.
More...