Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.24
PubTator Score 4.09

Knowledge Summary

Patent (3,444)

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.038 1.2e-02
adult high grade glioma -1.600 5.5e-04
astrocytic glioma -1.100 5.0e-03
Astrocytoma, Pilocytic -1.600 1.3e-06
atypical teratoid / rhabdoid tumor -1.700 7.3e-05
Breast cancer -1.400 5.0e-04
cystic fibrosis 1.087 1.7e-04
ependymoma -1.400 4.9e-09
gastric carcinoma -1.300 2.7e-02
glioblastoma -1.100 7.5e-05
group 4 medulloblastoma -1.100 1.5e-02
interstitial cystitis -1.100 8.9e-04
oligodendroglioma -1.100 1.4e-02
ovarian cancer 1.600 1.2e-03
primitive neuroectodermal tumor -1.500 1.4e-03
subependymal giant cell astrocytoma -1.334 9.4e-03

Gene RIF (3)

AA Sequence

MALRGAAGATDTPVSSAGGAPGGSASSSSTSSGGSASAGAGLWAALYDYEARGEDELSLRRGQLVEVLSQ      1 - 70
DAAVSGDEGWWAGQVQRRLGIFPANYVAPCRPAASPAPPPSRPSSPVHVAFERLELKELIGAGGFGQVYR     71 - 140
ATWQGQEVAVKAARQDPEQDAAAAAESVRREARLFAMLRHPNIIELRGVCLQQPHLCLVLEFARGGALNR    141 - 210
ALAAANAAPDPRAPGPRRARRIPPHVLVNWAVQIARGMLYLHEEAFVPILHRDLKSSNILLLEKIEHDDI    211 - 280
CNKTLKITDFGLAREWHRTTKMSTAGTYAWMAPEVIKSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGL    281 - 350
AVAYGVAVNKLTLPIPSTCPEPFAKLMKECWQQDPHIRPSFALILEQLTAIEGAVMTEMPQESFHSMQDD    351 - 420
WKLEIQQMFDELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAEREIDVLERELNILIFQLNQEK    421 - 490
PKVKKRKGKFKRSRLKLKDGHRISLPSDFQHKITVQASPNLDKRRSLNSSSSSPPSSPTMMPRLRAIQLT    491 - 560
SDESNKTWGRNTVFRQEEFEDVKRNFKKKGCTWGPNSIQMKDRTDCKERIRPLSDGNSPWSTILIKNQKT    561 - 630
MPLASLFVDQPGSCEEPKLSPDGLEHRKPKQIKLPSQAYIDLPLGKDAQRENPAEAESWEEAASANAATV    631 - 700
SIEMTPTNSLSRSPQRKKTESALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKS    701 - 770
RRSASPPTSLPSTCGEASSPPSLPLSSALGILSTPSFSTKCLLQMDSEDPLVDSAPVTCDSEMLTPDFCP    771 - 840
TAPGSGREPALMPRLDTDCSVSRNLPSSFLQQTCGNVPYCASSKHRPSHHRRTMSDGNPTPAGATIISAT    841 - 910
GASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVSQLAQTACVVGRPGP    911 - 980
HPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSKTSRPSIYELEKEFLS                  981 - 1036
//

Text Mined References (19)

PMID Year Title