Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
Funding $247,632.5
PubMed Score 6.79
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
21820496 Data suggest that results could be helpful for further investigations of the potential role of CYP4A variants in the genetic susceptibility to cardiovascular diseases such as arterial hypertension.
20079672 A homology model has been constructed for CYP4A22 and refined by molecular dynamics simulation.

AA Sequence

MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQ      1 - 70
ELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSYKFLAPRIGYGLLLLNGQTWF     71 - 140
QHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQGSIQV    141 - 210
DRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGEL    211 - 280
EKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREE    281 - 350
IHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH    351 - 420
NPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIP    421 - 490
MARLVLKSKNGIHLRLRRLPNPCEDKDQL                                             491 - 519
//

Text Mined References (11)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
21820496 2011 Genetic polymorphism of CYP4A11 and CYP4A22 genes and in silico insights from comparative 3D modelling in a French population.
20079672 2010 Molecular modeling study on orphan human protein CYP4A22 for identification of potential ligand binding site.
16806293 2006 Genetic polymorphisms and haplotype structures of the CYP4A22 gene in a Japanese population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15611369 2005 Functional variant of CYP4A11 20-hydroxyeicosatetraenoic acid synthase is associated with essential hypertension.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464262 2003 Characterization of the CYP4A11 gene, a second CYP4A gene in humans.
More...