Property Summary

NCBI Gene PubMed Count 24
PubMed Score 40.57
PubTator Score 19.67

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (10)

PMID Text
26489670 Crystal structures, small-angle X-ray scattering, and E2 profiling revealed that while the two paralogs are highly homologous, RC3H2 and RC3H1 are different in their structures and functions.
26249698 Roquin-1 and roquin-2 proteins function redundantly in mRNA degradation.
26170170 RC3H1 binds preferentially short-lived and DNA damage-induced mRNAs. Knockdown of RC3H1 resulted in increased A20 protein expression, thereby interfering with IkappaB kinase and NF-kappaB activities.
26165594 A distinct, sequence-induced conformation is required for recognition of the constitutive decay element RNA by Roquin.
26000482 Findings reveal that differential regulation of mRNAs by Regnase-1 and Roquin depends on their translation status and enables elaborate control of inflammation.
25955820 In this review we summarize current progress regarding the specific characteristics of sequences and structures in the 3' untranslated regions of mRNAs that are recognized by tristetraproline, Roquins, and Regnase-1.
25886994 decreased expression in colon biopsies of Crohn's disease patients but not in ulcerative colitis patients
25504471 Roquin binding to target mRNAs involves a winged helix-turn-helix motif.
25026078 Roquin-mediated degradation of HMGXB3 and IL6 mRNAs in human cells, demonstrates the importance of both binding sites for mRNA decay.
22685317 Excessive interferon (IFN)-gamma signaling promotes accumulation of Roquin-mutated, short-lived effector-like CD8+ T cells in autoimmune-prone transgenic mice.

AA Sequence

MPVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTINTDIELLPVNSAL      1 - 70
LQLVGAQVPEQQPITLCSGVEDTKHYEEAKKCVEELALYLKPLSSARGVGLNSTTQSVLSRPMQRKLVTL     71 - 140
VHCQLVEEEGRIRAMRAARSLGERTVTELILQHQNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLA    141 - 210
LEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALR    211 - 280
REHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTPASFAQSVQELTIALQRTGDPANL    281 - 350
NRLRPHLELLANIDPSPDAPPPTWEQLENGLVAVRTVVHGLVDYIQNHSKKGADQQQPPQHSKYKTYMCR    351 - 420
DMKQRGGCPRGASCTFAHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDEGAVDLPSRKP    421 - 490
PALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPGKIDHLSSSAPGSPPDLLESVPKSISALPVNPHSIPPR    491 - 560
GPADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAAPPFEPAPYQQGMYYTPPPQCVSRFVRPPPS    561 - 630
APEPAPPYLDHYPPYLQERVVNSQYGTQPQQYPPIYPSHYDGRRVYPAPSYTREEIFRESPIPIEIPPAA    631 - 700
VPSYVPESRERYQQIESYYPVAPHPTQIRPSYLREPPYSRLPPPPQPHPSLDELHRRRKEIMAQLEERKV    701 - 770
ISPPPFAPSPTLPPTFHPEEFLDEDLKVAGKYKGNDYSQYSPWSCDTIGSYIGTKDAKPKDVVAAGSVEM    771 - 840
MNVESKGMRDQRLDLQRRAAETSDDDLIPFGDRPTVSRFGAISRTSKTIYQGAGPMQAMAPQGAPTKSIN    841 - 910
ISDYSPYGTHGGWGASPYSPHQNIPSQGHFSERERISMSEVASHGKPLPSAEREQLRLELQQLNHQISQQ    911 - 980
TQLRGLEAVSNRLVLQREANTLAGQSQPPPPPPPKWPGMISSEQLSLELHQVEREIGKRTRELSMENQCS    981 - 1050
LDMKSKLNTSKQAENGQPEPQNKVPAEDLTLTFSDVPNGSALTQENISLLSNKTSSLNLSEDPEGGGDNN   1051 - 1120
DSQRSGVTPSSAP                                                            1121 - 1133
//

Text Mined References (27)

PMID Year Title
26489670 2015 New Insights into the RNA-Binding and E3 Ubiquitin Ligase Activities of Roquins.
26249698 2015 Structure of human Roquin-2 and its complex with constitutive-decay element RNA.
26170170 2015 RC3H1 post-transcriptionally regulates A20 mRNA and modulates the activity of the IKK/NF-?B pathway.
26165594 2015 A Distinct, Sequence-Induced Conformation Is Required for Recognition of the Constitutive Decay Element RNA by Roquin.
26000482 2015 Regnase-1 and Roquin Regulate a Common Element in Inflammatory mRNAs by Spatiotemporally Distinct Mechanisms.
25955820 2015 Emerging Roles of CCCH-Type Zinc Finger Proteins in Destabilizing mRNA Encoding Inflammatory Factors and Regulating Immune Responses.
25886994 2015 MicroRNA signatures differentiate Crohn's disease from ulcerative colitis.
25504471 2014 Roquin binding to target mRNAs involves a winged helix-turn-helix motif.
25026078 2014 The ROQ domain of Roquin recognizes mRNA constitutive-decay element and double-stranded RNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23825522 2013 ROQUIN/RC3H1 alterations are not found in angioimmunoblastic T-cell lymphoma.
23663784 2013 Roquin promotes constitutive mRNA decay via a conserved class of stem-loop recognition motifs.
23583642 2013 Roquin-2 shares functions with its paralog Roquin-1 in the repression of mRNAs controlling T follicular helper cells and systemic inflammation.
23550652 2013 Molecular control of Tfh-cell differentiation by Roquin family proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22685317 2012 Breakdown in repression of IFN-? mRNA leads to accumulation of self-reactive effector CD8+ T cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21844204 2011 Loss of Roquin induces early death and immune deregulation but not autoimmunity.
20412057 2010 The ROQUIN family of proteins localizes to stress granules via the ROQ domain and binds target mRNAs.
19217324 2009 Roquin differentiates the specialized functions of duplicated T cell costimulatory receptor genes CD28 and ICOS.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18172933 2007 Roquin represses autoimmunity by limiting inducible T-cell co-stimulator messenger RNA.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15917799 2005 A RING-type ubiquitin ligase family member required to repress follicular helper T cells and autoimmunity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.