Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.42
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 3.5e-10
osteosarcoma 7950 3.0e-05
group 3 medulloblastoma 4104 7.9e-03
primitive neuroectodermal tumor 3035 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 7.9e-03
osteosarcoma -1.154 3.0e-05
ovarian cancer 1.100 3.5e-10
primitive neuroectodermal tumor 1.100 1.0e-02

Gene RIF (1)

AA Sequence

MEKGGNIQLEIPDFSNSVLSHLNQLRMQGRLCDIVVNVQGQAFRAHKVVLAASSPYFRDHMSLNEMSTVS      1 - 70
ISVIKNPTVFEQLLSFCYTGRICLQLADIISYLTAASFLQMQHIIDKCTQILEGIHFKINVAEVEAELSQ     71 - 140
TRTKHQERPPESHRVTPNLNRSLSPRHNTPKGNRRGQVSAVLDIRELSPPEESTSPQIIEPSSDVESREP    141 - 210
ILRINRAGQWYVETGVADRGGRSDDEVRVLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTG    211 - 280
HGSVGQENYTLGSSGAKVARPTSSEVDRFSPSGSVVPLTERHRARSESPGRMDEPKQPSSQVEESAMMGV    281 - 350
SGYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYTRKDQLEYHI    351 - 420
RKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPHSISPETTVTSRGQAEEESPSQEETVAPG    421 - 490
EAVQGSVSTTGPD                                                             491 - 503
//

Text Mined References (6)

PMID Year Title