Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18187620 Knockdown of growth hormone regulated TBC protein 1 (GRTP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MQPAERSRVPRIDPYGFERPEDFDDAAYEKFFSSYLVTLTRRAIKWSRLLQGGGVPRSRTVKRYVRKGVP      1 - 70
LEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFPDNVKFRKTTDPCLQRTLYNV     71 - 140
LLAYGHHNQGVGYCQGMNFIAGYLILITNNEEESFWLLDALVGRILPDYYSPAMLGLKTDQEVLGELVRA    141 - 210
KLPAVGALMERLGVLWTLLVSRWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQELILEA    211 - 280
TSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCRARLLAQG                  281 - 336
//

Text Mined References (8)

PMID Year Title
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11564724 2001 Grtp1, a novel gene regulated by growth hormone.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.