Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
non-small cell lung cancer 2798 3.09342135411567E-18
posterior fossa group B ependymoma 1530 2.18776037008401E-7
interstitial cystitis 2299 1.44422548676547E-5
atypical teratoid / rhabdoid tumor 4369 4.30371135732764E-5
osteosarcoma 7933 2.93757904981838E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.80904795899783E-4
pancreatic cancer 2300 6.88726246541989E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0014975951451488
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00164320907851549
Breast cancer 3099 0.0120047978575545
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0166535334334657

Expression

Synonym

Accession Q5TC63 B9A6K2 Q2M232 Q5TC64 Q66K26 Q6P659 Q8N528 Q9H695
Symbols TBC1D6

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (1)

PMID Text
18187620 Knockdown of growth hormone regulated TBC protein 1 (GRTP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MQPAERSRVPRIDPYGFERPEDFDDAAYEKFFSSYLVTLTRRAIKWSRLLQGGGVPRSRTVKRYVRKGVP      1 - 70
LEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFPDNVKFRKTTDPCLQRTLYNV     71 - 140
LLAYGHHNQGVGYCQGMNFIAGYLILITNNEEESFWLLDALVGRILPDYYSPAMLGLKTDQEVLGELVRA    141 - 210
KLPAVGALMERLGVLWTLLVSRWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQELILEA    211 - 280
TSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCRARLLAQG                  281 - 336
//

Text Mined References (8)

PMID Year Title
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11564724 2001 Grtp1, a novel gene regulated by growth hormone.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.