Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.35

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MQPAERSRVPRIDPYGFERPEDFDDAAYEKFFSSYLVTLTRRAIKWSRLLQGGGVPRSRTVKRYVRKGVP      1 - 70
LEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFPDNVKFRKTTDPCLQRTLYNV     71 - 140
LLAYGHHNQGVGYCQGMNFIAGYLILITNNEEESFWLLDALVGRILPDYYSPAMLGLKTDQEVLGELVRA    141 - 210
KLPAVGALMERLGVLWTLLVSRWFICLFVDILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQELILEA    211 - 280
TSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCRARLLAQG                  281 - 336
//

Text Mined References (8)

PMID Year Title