Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.35
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis -1.051 5.7e-03
adult high grade glioma -1.900 1.0e-05
astrocytic glioma -1.500 3.3e-02
Astrocytoma, Pilocytic -1.600 2.0e-06
atypical teratoid / rhabdoid tumor -1.500 2.3e-05
ependymoma -2.000 7.1e-03
glioblastoma -1.400 6.0e-06
medulloblastoma, large-cell -1.300 9.8e-04
oligodendroglioma -1.800 1.1e-02
osteosarcoma -1.459 7.2e-05
ovarian cancer -1.300 1.0e-04
pancreatic ductal adenocarcinoma liver m... -1.445 1.3e-02
Pick disease -1.500 4.6e-04
primitive neuroectodermal tumor -1.200 3.9e-03
tuberculosis 1.100 1.7e-06

Synonym

Accession Q5TC12 B1AQW7 B7Z7D6 B7Z7I6 Q9H6E3
Symbols ATP11
ATP11p

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAE      1 - 70
LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK     71 - 140
DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF    141 - 210
VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY    211 - 280
ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT                          281 - 328
//

Text Mined References (14)

PMID Year Title