Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 7
Funding $402,569.3
PubMed Score 17.18
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 0.033
ependymoma -2.000 0.007
oligodendroglioma -1.800 0.011
glioblastoma -2.100 0.000
osteosarcoma -1.459 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.300 0.001
primitive neuroectodermal tumor -1.200 0.004
pancreatic ductal adenocarcinoma liver m... -1.445 0.013
tuberculosis 1.100 0.000
ulcerative colitis -1.200 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.600 0.000
Pick disease -1.500 0.000
ovarian cancer 1.700 0.001

Gene RIF (3)

PMID Text
21696813 Asthma was found to be associated with a cluster of SNPs and SNP haplotypes containing the ATPAF1 gene
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAE      1 - 70
LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK     71 - 140
DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF    141 - 210
VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY    211 - 280
ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT                          281 - 328
//

Text Mined References (14)

PMID Year Title
21696813 2011 Identification of ATPAF1 as a novel candidate gene for asthma in children.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20579638 2010 OGFOD1, a member of the 2-oxoglutarate and iron dependent dioxygenase family, functions in ischemic signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15789402 2005 Assembly factors of F1FO-ATP synthase across genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...