Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.18
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Obesity 616
Disease Target Count P-value
tuberculosis 1563 1.70912844526959E-6
pilocytic astrocytoma 3086 1.84772905491867E-6
glioblastoma 5572 7.24038325520048E-6
adult high grade glioma 2148 1.02780038182937E-5
atypical teratoid / rhabdoid tumor 4369 2.3094744453906E-5
osteosarcoma 7933 7.23544247587786E-5
ulcerative colitis 2087 2.59848971628521E-4
Pick disease 1893 4.6342126293697E-4
medulloblastoma, large-cell 6234 9.83400441605648E-4
ovarian cancer 8492 0.0011739366685719
primitive neuroectodermal tumor 3031 0.00394872457057087
ependymoma 2514 0.00711466034904644
oligodendroglioma 2849 0.0108008679530167
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0128536492914021
astrocytic glioma 2241 0.0329965195728291

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 0.033
ependymoma -2.000 0.007
oligodendroglioma -1.800 0.011
glioblastoma -2.100 0.000
osteosarcoma -1.459 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.300 0.001
primitive neuroectodermal tumor -1.200 0.004
pancreatic ductal adenocarcinoma liver m... -1.445 0.013
tuberculosis 1.100 0.000
ulcerative colitis -1.200 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.600 0.000
Pick disease -1.500 0.000
ovarian cancer 1.700 0.001

Synonym

Accession Q5TC12 B1AQW7 B7Z7D6 B7Z7I6 Q9H6E3
Symbols ATP11
ATP11p

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (3)

PMID Text
21696813 Asthma was found to be associated with a cluster of SNPs and SNP haplotypes containing the ATPAF1 gene
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAE      1 - 70
LQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTK     71 - 140
DKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFF    141 - 210
VGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFY    211 - 280
ATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT                          281 - 328
//

Text Mined References (14)

PMID Year Title
21696813 2011 Identification of ATPAF1 as a novel candidate gene for asthma in children.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20579638 2010 OGFOD1, a member of the 2-oxoglutarate and iron dependent dioxygenase family, functions in ischemic signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15789402 2005 Assembly factors of F1FO-ATP synthase across genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...