Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.5e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.180 2.5e-08

Synonym

Accession Q5TC04
Symbols ATP1A1OS
C1orf203

 Compartment GO Term (0)

AA Sequence

MAHFKDDLQTNVEIIPGESAPRKESPRPPAPPSSAAGVGGCSNHSPSVQESPLSPPALAQLGSAQQPSMR      1 - 70
TELSFSEKKDTMIIWQITITVWCQR                                                  71 - 95
//

Text Mined References (3)

PMID Year Title