Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
posterior fossa group B ependymoma -2.200 0.000
oligodendroglioma -1.500 0.002
psoriasis -1.600 0.000
osteosarcoma -2.050 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.500 0.003
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -1.400 0.001
non-small cell lung cancer -2.041 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.000
Hydrolethalus syndrome 1.169 0.039
lung cancer -2.600 0.000
colon cancer -1.100 0.021
pediatric high grade glioma -1.200 0.000
aldosterone-producing adenoma -1.166 0.020
Breast cancer -2.000 0.000
Pick disease -1.400 0.000
invasive ductal carcinoma -1.200 0.005
acute myeloid leukemia -1.600 0.006
ovarian cancer -2.300 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q5TBK1 A4QN21 Q5TBK0
Symbols CG018

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRAL      1 - 70
IFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEV     71 - 140
IFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNAR    141 - 210
YWNSYTEFPNRRAHGGFTNESSYHRRGGCHHGY                                         211 - 243
//

Text Mined References (8)

PMID Year Title
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812419 1996 Generation of an integrated transcription map of the BRCA2 region on chromosome 13q12-q13.