Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 6.03206817358749E-23
Breast cancer 3099 1.60143146313544E-12
ovarian cancer 8492 6.17748954391387E-8
psoriasis 6685 1.32428027199845E-7
posterior fossa group B ependymoma 1530 2.4886116020184E-7
glioblastoma 5572 9.14365395154982E-7
lung cancer 4473 5.34675835435666E-6
atypical teratoid / rhabdoid tumor 4369 7.11307471699933E-6
malignant mesothelioma 3163 4.42709507890309E-5
medulloblastoma, large-cell 6234 5.17437582796586E-5
pituitary cancer 1972 6.91897482862065E-5
pediatric high grade glioma 2712 7.97199032425024E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.20402253649432E-4
Pick disease 1893 3.79280242900664E-4
osteosarcoma 7933 4.83739816915439E-4
primitive neuroectodermal tumor 3031 8.93249025807289E-4
oligodendroglioma 2849 0.00248615162334358
medulloblastoma 1524 0.0026047800633188
invasive ductal carcinoma 2950 0.00463282346554868
acute myeloid leukemia 785 0.00622337337408328
aldosterone-producing adenoma 664 0.0196507843046885
colon cancer 1475 0.0210686899320704
Hydrolethalus syndrome 128 0.038925740801103

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
posterior fossa group B ependymoma -2.200 0.000
oligodendroglioma -1.500 0.002
psoriasis -1.600 0.000
osteosarcoma -2.050 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.500 0.003
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -1.400 0.001
non-small cell lung cancer -2.041 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.000
Hydrolethalus syndrome 1.169 0.039
lung cancer -2.600 0.000
colon cancer -1.100 0.021
pediatric high grade glioma -1.200 0.000
aldosterone-producing adenoma -1.166 0.020
Breast cancer -2.000 0.000
Pick disease -1.400 0.000
invasive ductal carcinoma -1.200 0.005
acute myeloid leukemia -1.600 0.006
ovarian cancer -2.300 0.000
pituitary cancer 1.100 0.000

Synonym

Accession Q5TBK1 A4QN21 Q5TBK0
Symbols CG018

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG
Cow EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRAL      1 - 70
IFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMALENNYEV     71 - 140
IFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNNAR    141 - 210
YWNSYTEFPNRRAHGGFTNESSYHRRGGCHHGY                                         211 - 243
//

Text Mined References (8)

PMID Year Title
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812419 1996 Generation of an integrated transcription map of the BRCA2 region on chromosome 13q12-q13.